DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and fgl1b

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_002936775.2 Gene:fgl1b / 100497330 XenbaseID:XB-GENE-5957151 Length:330 Species:Xenopus tropicalis


Alignment Length:326 Identity:107/326 - (32%)
Similarity:156/326 - (47%) Gaps:61/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAIKEKDEQIKELE-----QKVKVYETRLKRKQHVLAELRKLNGSSALLIEHLKGKVVYFERKFR 192
            :|.:.||.:|.:::     |:::|.:.:|....   ..||.|.|::   ...||.| |:.....|
 Frog    16 SAPRLKDLEICQIDNIKLLQRIQVLQNQLHLGD---LHLRDLLGNN---YHSLKSK-VFKSSSHR 73

  Fly   193 EKKDDLLAD--------WEAATTSCVPFGRSPGIHLIHLPGFL---------PFLVPCEGQTAAG 240
            .|.:|:|..        :....:|....||...       |:.         ||||.|:  .:.|
 Frog    74 SKVEDVLLPTTSGNLIVYNEDCSSVFESGRKES-------GYYRVRPRAENEPFLVFCD--MSDG 129

  Fly   241 PGWTCIQRRLDGSVNFYRNWDAYSKGFG---KLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGE 302
            .|||.||||.:|.|||.|.||.|.:|||   ..|.|.:||...::.|...:...|.|.:..:.|.
 Frog   130 GGWTVIQRRSNGKVNFNRKWDEYKEGFGLFKSRNDEHWIGNNHIYDLLDKREMTLKIDLTDWQGN 194

  Fly   303 TSYAHYDDFLIGSEEEGYELKLLGHYQGNASDAL-----------RTHDKMKFSTYDRDNDAFTH 356
            ..:|.|:.|.:.:|::.|:| .:|:|.|||.|.|           .:|..|.|||.|:|||.|..
 Frog   195 AKHAIYETFRLTNEQDNYKL-WIGYYSGNAGDGLSGGSNFEQQWSASHSGMPFSTSDKDNDRFIK 258

  Fly   357 MNCAEHHQGAWWYDFCSRSNLNGRYFK-----GEVDNPQSIYWEPWYS-FRSLKSVQMLIRPKSQ 415
            .|||:.::..||::.|..:||||.|:|     ||.||  .|.|.||:. :.||||..|.||..|.
 Frog   259 GNCAKENKCGWWFNRCHAANLNGVYYKKGNYTGEFDN--GIVWSPWHGLWYSLKSTAMKIRRPSF 321

  Fly   416 L 416
            |
 Frog   322 L 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 7/34 (21%)
FReD 213..413 CDD:238040 85/228 (37%)
fgl1bXP_002936775.2 FReD 94..318 CDD:238040 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.