DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and tnxb

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_031747219.1 Gene:tnxb / 100489649 XenbaseID:XB-GENE-481849 Length:2840 Species:Xenopus tropicalis


Alignment Length:290 Identity:102/290 - (35%)
Similarity:147/290 - (50%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 DEQIKELEQKVKVYETRLKRKQHV---------LAELRKLNGSSALLIEHLKGKVVY-FERKFRE 193
            |.:||||.....:....|   .|:         |..||..:.|:.:......|::.| |.|...|
 Frog  2568 DGEIKELILLANLSSFTL---SHLTPSTPYKVQLHALRGASSSAPISTSFTTGRIRYPFPRDCWE 2629

  Fly   194 K--KDDLLADWEAATTSCVPFGRSPGIHLIHLPGFL--PFLVPCEGQTAAGPGWTCIQRRLDGSV 254
            |  ..||                ..|:..|:|.|..  |.||.|:.:|..| ||...|||:||..
 Frog  2630 KHMNGDL----------------QSGVFTIYLGGSKDDPLLVYCDMETDGG-GWIVFQRRIDGRT 2677

  Fly   255 NFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEG 319
            :|:|||..|.:|||.|..||::|...||||:|..|:||.:.:|. |.|.:||.|:||.:..|::.
 Frog  2678 DFWRNWRQYKEGFGNLTSEFWLGNIALHRLSSLAPYELRVDLRA-GAEAAYAVYEDFRVEGEDKH 2741

  Fly   320 YELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKG 384
            :.|: :|.|:|||.|:|..|:.|.|||.|||.:. ..:.|:..::|||||..|..:||||.|  |
 Frog  2742 FRLR-IGAYRGNAGDSLSYHNNMIFSTRDRDAEK-RILPCSISYRGAWWYKNCHYANLNGMY--G 2802

  Fly   385 EVDNPQSIYWEPWYSFR-SLKSVQMLIRPK 413
            ...:.|.:.|..|..|. |:...:|.:||:
 Frog  2803 NNKDHQGVNWHTWKGFEFSIPFTEMKMRPQ 2832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 7/32 (22%)
FReD 213..413 CDD:238040 82/202 (41%)
tnxbXP_031747219.1 EGF_Tenascin 179..206 CDD:376143
exchanger_TraA <400..779 CDD:411343
EGF_Tenascin 799..826 CDD:376143
fn3 834..913 CDD:394996
FN3 923..998 CDD:214495
fn3 1790..1852 CDD:394996
fn3 1881..1960 CDD:394996
fn3 1972..2051 CDD:394996
fn3 2064..2141 CDD:394996
fn3 2170..2245 CDD:394996
fn3 2267..2338 CDD:394996
FN3 2356..2433 CDD:238020
fn3 2445..2522 CDD:394996
fn3 2531..2609 CDD:394996 11/43 (26%)
FReD 2622..2831 CDD:238040 87/230 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.