DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and mfap4.2

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_012826893.1 Gene:mfap4.2 / 100488329 XenbaseID:XB-GENE-22167947 Length:261 Species:Xenopus tropicalis


Alignment Length:209 Identity:73/209 - (34%)
Similarity:112/209 - (53%) Gaps:15/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RSPGIHLIHLPG---FLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFF 275
            :..|:::|:..|   .||  |.|: .|.....||.||:|.|||::|.|.|..|..|||:.:.|::
 Frog    46 KEDGVYIIYPAGSSSALP--VYCD-MTTDEAKWTVIQKRFDGSLSFSRGWTDYKLGFGRADEEYW 107

  Fly   276 IGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDF-----LIGSEEEGYELKLLGHYQGNASDA 335
            :||..:::||..:.:.|.|.:..|...|::|.|.||     .|..|::||.|.:.|...|.|.|:
 Frog   108 LGLHNIYQLTLQKKYMLRIELGDFENNTAHAEYTDFSLSPNAINPEDDGYTLFVDGFIDGGAGDS 172

  Fly   336 LRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGE--VDNPQSIYWEPWY 398
            |..|:.|||||:|.|.|.: ..|||..:...:|:..|..:|:||.|.:..  ..:...|.|..|.
 Frog   173 LTFHNGMKFSTFDHDQDTY-QQNCAFLYSSGFWFKGCHLANINGPYLQDATYTSSGNGITWTRWK 236

  Fly   399 SFR-SLKSVQMLIR 411
            .|. |||:.::.||
 Frog   237 GFNYSLKTTEIKIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 73/209 (35%)
mfap4.2XP_012826893.1 FReD 32..252 CDD:238040 73/209 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.