DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and XB5913531

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_012826224.3 Gene:XB5913531 / 100488177 XenbaseID:XB-GENE-5913532 Length:255 Species:Xenopus tropicalis


Alignment Length:211 Identity:77/211 - (36%)
Similarity:115/211 - (54%) Gaps:17/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RSPGIHLIHLPG-FLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIG 277
            ||.|.:||:..| ..|..|.|: .|..|..||..|:|.|||.:|.:||..|..|||..:.|:::|
 Frog    47 RSDGEYLIYPQGPQHPLPVYCD-MTTNGMPWTVFQKRFDGSTDFNQNWQDYVMGFGNADYEYWLG 110

  Fly   278 LEKLHRLTSSQPHELYISIRRFGGETSYAHYDDF-----LIGSEEEGYELKLLGHYQGNASDALR 337
            |:.:.|||.:..:||.:.:..|.|:..||.|.:|     .:.:|.:||:|.:.|...|.|.|:|.
 Frog   111 LQNIQRLTMTGRYELRVELENFNGQKVYAFYSNFSLSPQALNAEHDGYKLYVDGFTDGGAGDSLS 175

  Fly   338 THDKMKFSTYDRD--NDAFTHMNCAEHHQGAWWY--DFCSRSNLNGRYFK-GEVDNPQ-SIYWEP 396
            .|...:|||||.|  ||.   .||||:..|.:||  :.|:.:.||.||.. ..:.:|| ...|..
 Frog   176 VHVGQRFSTYDNDQINDI---QNCAEYWGGGFWYYSNGCADAGLNARYINPNTLKSPQHGFSWVT 237

  Fly   397 WYSF-RSLKSVQMLIR 411
            |..: .:|::.||::|
 Frog   238 WVEYPETLRASQMMMR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 77/211 (36%)
XB5913531XP_012826224.3 FReD 33..255 CDD:238040 77/211 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.