DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and fibcd1a

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_005166963.1 Gene:fibcd1a / 100151577 ZFINID:ZDB-GENE-081105-148 Length:464 Species:Danio rerio


Alignment Length:368 Identity:122/368 - (33%)
Similarity:184/368 - (50%) Gaps:42/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DQHKTIRISKGDLDDLLDVYMGKIAESAATIKDKENEINKL-QTKDQTGDEL--LRKFE-NLTQV 123
            |....::..||....||.....::|:.:|.....:.|.|.| |.:...|.||  |:..: .|.|:
Zfish   121 DHDTDLKSVKGQDRALLVKLAEEVAKLSAHASQLKMEYNALRQGQGNIGQELSTLQTEQGRLIQL 185

  Fly   124 CSAQQSSFTTAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGSSALLIEHLKGKVVYFE 188
            .|..|.:....:....:.:..::::....::|||      |:|::....|.    ..||......
Zfish   186 LSESQINMVKVVNSVSDALSSMQKENGNIKSRLK------ADLQRAPVRSV----RPKGCAAGEG 240

  Fly   189 RKFREKKDDLLADWEAATTSCVPFGRSPGIHLI---HLP-GFLPFLVPCEGQTAAGPGWTCIQRR 249
            .:.|: ..|:.|..:          |..||:.:   |.| ||..|   |: .|..|.|||.||||
Zfish   241 SRPRD-CSDIYASGQ----------REDGIYSVFPTHYPAGFQVF---CD-MTTDGGGWTVIQRR 290

  Fly   250 LDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIG 314
            .||||||:|:|:||.:||||:.||.::|::::|.||....:||.|.:..|...||:|.|..|.:|
Zfish   291 EDGSVNFFRDWEAYREGFGKITGEHWLGMKRIHALTIQANYELRIDLEDFENSTSFAQYGSFGVG 355

  Fly   315 -----SEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSR 374
                 .:|:||.|. :..|.|.|.|:|..|:.|||:|.|:||| .:..|||..:.|||||..|..
Zfish   356 LFSVDPDEDGYPLS-IADYSGTAGDSLLKHNGMKFTTKDKDND-HSENNCASFYHGAWWYRNCHT 418

  Fly   375 SNLNGRYFKGE-VDNPQSIYWEPWYSFR-SLKSVQMLIRPKSQ 415
            |||||:|.:|: ......|.|..|..:: |||..:|.|||..:
Zfish   419 SNLNGQYLRGQHTSYADGIEWSSWTGWQYSLKFTEMKIRPTKE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 21/94 (22%)
FReD 213..413 CDD:238040 91/210 (43%)
fibcd1aXP_005166963.1 FReD 243..458 CDD:238040 93/231 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.