DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and znf1003

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001104681.1 Gene:znf1003 / 793476 ZFINID:ZDB-GENE-080219-42 Length:336 Species:Danio rerio


Alignment Length:173 Identity:66/173 - (38%)
Similarity:95/173 - (54%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 KVHRSAHDGTQPFICTLCGKGFQMPCNLTVHIRRHRRDFPYSCEQCDKRFATSTEVAIHLRTHTG 769
            |||.|.|...:|..||||||.::...:|..|.:.|..:.||:|:||.|||..|:.:..|::.|||
Zfish    76 KVHHSVHTEVKPNSCTLCGKSYKQLSHLQQHQKIHTGERPYTCDQCGKRFRRSSTLNQHMKIHTG 140

  Fly   770 ERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHCPICAKGFYEKNRFTDHMNSHWAIRKHLCTVC 834
            |||:.||.||::|...|....|...|.|:..:.|..|.|.|...:....|...|..:::|:|..|
Zfish   141 ERPHYCDQCGRTFLRTSELRRHLTVHTNEKPYSCSECGKSFSRLSNLKVHQKIHAGVKEHVCIEC 205

  Fly   835 GKTFTTYGNLKKHTELHLAVKKYKCGTCGKRFAQFASLRWHKK 877
            ||:|.....|:.|..:|...|.|||..|.|||:...||:.|::
Zfish   206 GKSFINAQVLQIHQRIHTGEKPYKCSHCDKRFSLLHSLKSHER 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510
MADF_DNA_bdg 595..682 CDD:287510
C2H2 Zn finger 691..711 CDD:275368 4/5 (80%)
C2H2 Zn finger 719..739 CDD:275368 8/19 (42%)
zf-H2C2_2 731..756 CDD:290200 11/24 (46%)
COG5048 742..>824 CDD:227381 30/81 (37%)
C2H2 Zn finger 747..767 CDD:275368 8/19 (42%)
zf-H2C2_2 763..784 CDD:290200 12/20 (60%)
C2H2 Zn finger 775..795 CDD:275368 7/19 (37%)
C2H2 Zn finger 803..818 CDD:275368 4/14 (29%)
C2H2 Zn finger 831..851 CDD:275368 7/19 (37%)
C2H2 Zn finger 859..877 CDD:275368 8/17 (47%)
znf1003NP_001104681.1 COG5048 <36..269 CDD:227381 66/173 (38%)
C2H2 Zn finger 90..110 CDD:275368 8/19 (42%)
zf-H2C2_2 102..127 CDD:290200 11/24 (46%)
C2H2 Zn finger 118..138 CDD:275368 8/19 (42%)
zf-H2C2_2 131..155 CDD:290200 12/23 (52%)
C2H2 Zn finger 146..166 CDD:275368 7/19 (37%)
zf-H2C2_2 158..183 CDD:290200 7/24 (29%)
C2H2 Zn finger 174..194 CDD:275368 5/19 (26%)
C2H2 Zn finger 202..222 CDD:275368 7/19 (37%)
zf-H2C2_2 215..238 CDD:290200 10/22 (45%)
C2H2 Zn finger 230..250 CDD:275368 8/19 (42%)
zf-H2C2_2 242..267 CDD:290200 3/7 (43%)
C2H2 Zn finger 258..278 CDD:275368
C2H2 Zn finger 286..306 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.