DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and ZIPIC

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:455 Identity:98/455 - (21%)
Similarity:167/455 - (36%) Gaps:120/455 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 LFRDISVQLQEELNYELSGE------ECCNEIQKLRTRYRKELRMVIKHKG-----LYLP----- 540
            |..::.:|.....||.|:.|      :||.::    .||.|.:::..|.:|     ::.|     
  Fly    27 LISELVLQCTRGTNYVLTEESSTICKKCCEKL----ARYHKSIQIARKLRGEILELIHSPYMSKD 87

  Fly   541 -KLWCYDE----------------MEFLQPILQEQIFNKISKKIGVVG--------SNQKTKFID 580
             |...|.|                .|..|...:||....:...:.:||        :.::..|| 
  Fly    88 HKQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQELESVGTTVTLVGPAGIVEEVAEEEHTFI- 151

  Fly   581 ASSIRFDNTEKQLQFVEIYHNYSALWDVDHPDFRSNTYRSQALGQMLDEINTTFHTSYTAEQL-- 643
                     .||.:..:.:|:.....|:|: :...|...:..:.::..||....|.....:.|  
  Fly   152 ---------IKQSEEEDEFHSVDLELDIDN-EIIINEEEAHEVEEVAHEIEEVAHEIEEEDLLPH 206

  Fly   644 ------------EKTLFNLRKEFSAQKRKILTESEDSSSIPLLHAKLAEFLDQNLGPF----RCD 692
                        |.|:.:..:........|:::.||.           |..:::.|.:    :|.
  Fly   207 DKQEAQEEDFFKEDTMSDFDEHLDGAIEYIISDGEDQ-----------EQDNESSGEYTVNIQCP 260

  Fly   693 ICSDLVKTCDQYKVH--RSAHDGTQPFICTLCGKGFQMPCNLTVHIRRHRRDFPYSCEQCDKRFA 755
            .|.:...:...|.||  |....|   ::|..|||..|.......|::.|.....::|..|.:||:
  Fly   261 SCPEKFSSRRAYNVHTKREHFPG---YVCDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERFS 322

  Fly   756 TSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHCPICAKGFYEKNRFTDHM 820
            ....:..|:..|:||.||.||:|.|.|       :|:               ...|:      |.
  Fly   323 RKFRLKHHMAWHSGETPYQCDVCSKRF-------VHK---------------VALYK------HK 359

  Fly   821 NSHWAIRKHL-CTVCGKTFTTYGNLKKHTELHLAVKKYKCGTCGKRFAQFASLRWHKKREHSSVG 884
            ..|.:..|.| |.|||....|..:|::|...|...|.:.|..|.|||:|..:::.| .|||.|.|
  Fly   360 MIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAH-LREHESPG 423

  Fly   885  884
              Fly   424  423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510 18/91 (20%)
MADF_DNA_bdg 595..682 CDD:287510 14/100 (14%)
C2H2 Zn finger 691..711 CDD:275368 6/21 (29%)
C2H2 Zn finger 719..739 CDD:275368 6/19 (32%)
zf-H2C2_2 731..756 CDD:290200 6/24 (25%)
COG5048 742..>824 CDD:227381 18/81 (22%)
C2H2 Zn finger 747..767 CDD:275368 5/19 (26%)
zf-H2C2_2 763..784 CDD:290200 11/20 (55%)
C2H2 Zn finger 775..795 CDD:275368 6/19 (32%)
C2H2 Zn finger 803..818 CDD:275368 1/14 (7%)
C2H2 Zn finger 831..851 CDD:275368 7/19 (37%)
C2H2 Zn finger 859..877 CDD:275368 7/17 (41%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
zf-H2C2_2 327..351 CDD:290200 11/30 (37%)
C2H2 Zn finger 342..391 CDD:275368 18/76 (24%)
zf-H2C2_2 383..408 CDD:290200 9/24 (38%)
C2H2 Zn finger 399..419 CDD:275368 8/20 (40%)
C2H2 Zn finger 432..449 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.