DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and CG4730

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster


Alignment Length:474 Identity:97/474 - (20%)
Similarity:167/474 - (35%) Gaps:142/474 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 LRCVIENRRAEREAK-ISNESTESEKSCETDADSCGKSSLYHEVLSFILD---AFKRQECLWNPQ 480
            |...|..|.||...| :|:|.:.|:.:...:..:|.:..|.....:.:||   .:.::..|   .
  Fly    12 LNFTIARRTAEAPVKLVSHEVSLSDSTTSLELSNCCRLCLEEPYPNQMLDMTVIYDQEAAL---S 73

  Fly   481 HYD-YTTCCKTELFRDISVQLQEELNYELSGEECCNEIQKLRTRYRKELRMVIKHKGLYLPKLWC 544
            :|| |..|.|.:|.::..                 ||.:.|..|...||:             |.
  Fly    74 YYDCYEICTKEDLRQNPK-----------------NEPRTLCKRCAVELK-------------WA 108

  Fly   545 YDEMEFLQPILQEQIFNKISKKIGVVGSNQKTKFIDASSIRFDNTEKQLQFVEIYHNYSALWDVD 609
            ||                ..||:.:.....:..|:...:    |||::             .||:
  Fly   109 YD----------------FHKKMAIANQQLREIFVATEA----NTEQE-------------DDVE 140

  Fly   610 HPDFRSNTYRSQALGQMLDEINTTFHTSYTAEQLEKTLFNLRKEFSAQKRKILTESEDSSSIPLL 674
                              ||.|..               ::.:||      ::.|.|:....|: 
  Fly   141 ------------------DEENEA---------------DMNEEF------LMEEIEEKQETPI- 165

  Fly   675 HAKLAEFLDQNLGPFRCDICSDLVKTCDQYKVHRSAHDGTQPFICTLCGKGFQMPCNLTVHIRRH 739
                             |...|:|.        |:.|.|...  |..|.|.|:....:..|...|
  Fly   166 -----------------DSLEDIVP--------RNRHTGKSN--CKFCHKEFRNHSRMAKHQMIH 203

  Fly   740 RRDFP-YSCEQCDKRFATSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHC 803
            ..:.| :.|.|||:.:.|...:.:|:.:...:....||.|||.|......:||:|.|.....:.|
  Fly   204 LANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSC 268

  Fly   804 PICAKGFYEKNRFTDHMNSHWAIRKHLCTV--CGKTFTTYGNLKKHTELHLAVKKYKCGTCGKRF 866
            .:|.:.|.:::..|.|.....:..:.:|..  |.|:||:..:|:.|...|.|: .::|..|.:.:
  Fly   269 DLCDRRFAQRSHLTVHQQVKHSGSRFICEFPGCQKSFTSSSSLRNHECTHTAM-PFECAHCHQSY 332

  Fly   867 AQFASLRWHKKREHSSVGQ 885
            .....||.|.:|:|:.|.|
  Fly   333 PARNKLRMHLERKHNMVVQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510 97/474 (20%)
MADF_DNA_bdg 465..551 CDD:287510 18/89 (20%)
MADF_DNA_bdg 595..682 CDD:287510 10/86 (12%)
C2H2 Zn finger 691..711 CDD:275368 4/19 (21%)
C2H2 Zn finger 719..739 CDD:275368 5/19 (26%)
zf-H2C2_2 731..756 CDD:290200 7/25 (28%)
COG5048 742..>824 CDD:227381 22/82 (27%)
C2H2 Zn finger 747..767 CDD:275368 6/19 (32%)
zf-H2C2_2 763..784 CDD:290200 7/20 (35%)
C2H2 Zn finger 775..795 CDD:275368 9/19 (47%)
C2H2 Zn finger 803..818 CDD:275368 3/14 (21%)
C2H2 Zn finger 831..851 CDD:275368 7/21 (33%)
C2H2 Zn finger 859..877 CDD:275368 5/17 (29%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 22/126 (17%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..289 CDD:275368 5/20 (25%)
C2H2 Zn finger 296..318 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..346 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.