DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and CG7963

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:110/260 - (42%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 SAQKRKILTESEDSSSI-PLLHAKLAEFLDQN----LGPFRCDICSDLVKTCDQYKVHRSAHDGT 714
            :|:.|||..|||....: |.::...||.|...    :.|      ||.::.....:...:...|.
  Fly    67 AAKFRKICVESEKLRDMAPEINIDTAEPLASEEIIIIDP------SDYIEQLSAVEDPENEPIGV 125

  Fly   715 QPFICTLCGKGFQMPCNLTVHI------------RRHRRDFP-------------------YSCE 748
            ..:.|..||.|||:...|..||            |..||.|.                   :.|.
  Fly   126 SRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCL 190

  Fly   749 QCDKRFATSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHCPICAKGFYEK 813
            :|.|...:::.:|.|:|.||.|.|:.||.|.|:|:|....::|:|||.......|..|.:||.|.
  Fly   191 ECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVES 255

  Fly   814 NRFTDH-MNSHWAIRKHLCTVCGKTFTTYGNLKKHTELHLAVKKYKCGTCGKRFAQFASLRWHKK 877
            :....| :|.|...|.|||.|..::|:....|:.|...:...:.|.|....|||||...|:.|::
  Fly   256 SNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHER 320

  Fly   878  877
              Fly   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510
MADF_DNA_bdg 595..682 CDD:287510 10/27 (37%)
C2H2 Zn finger 691..711 CDD:275368 2/19 (11%)
C2H2 Zn finger 719..739 CDD:275368 10/31 (32%)
zf-H2C2_2 731..756 CDD:290200 10/55 (18%)
COG5048 742..>824 CDD:227381 28/101 (28%)
C2H2 Zn finger 747..767 CDD:275368 6/19 (32%)
zf-H2C2_2 763..784 CDD:290200 11/20 (55%)
C2H2 Zn finger 775..795 CDD:275368 8/19 (42%)
C2H2 Zn finger 803..818 CDD:275368 5/14 (36%)
C2H2 Zn finger 831..851 CDD:275368 5/19 (26%)
C2H2 Zn finger 859..877 CDD:275368 8/17 (47%)
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 7/12 (58%)
C2H2 Zn finger 159..179 CDD:275368 4/19 (21%)
COG5048 184..>250 CDD:227381 22/65 (34%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..262 CDD:275368 5/16 (31%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..339 CDD:290200 2/6 (33%)
C2H2 Zn finger 330..350 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.