Sequence 1: | NP_001163089.2 | Gene: | rgr / 35843 | FlyBaseID: | FBgn0267792 | Length: | 889 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649798.3 | Gene: | CG7963 / 41001 | FlyBaseID: | FBgn0037584 | Length: | 354 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 73/260 - (28%) |
---|---|---|---|
Similarity: | 110/260 - (42%) | Gaps: | 43/260 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 655 SAQKRKILTESEDSSSI-PLLHAKLAEFLDQN----LGPFRCDICSDLVKTCDQYKVHRSAHDGT 714
Fly 715 QPFICTLCGKGFQMPCNLTVHI------------RRHRRDFP-------------------YSCE 748
Fly 749 QCDKRFATSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHCPICAKGFYEK 813
Fly 814 NRFTDH-MNSHWAIRKHLCTVCGKTFTTYGNLKKHTELHLAVKKYKCGTCGKRFAQFASLRWHKK 877
Fly 878 877 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rgr | NP_001163089.2 | MADF_DNA_bdg | 335..420 | CDD:287510 | |
MADF_DNA_bdg | 465..551 | CDD:287510 | |||
MADF_DNA_bdg | 595..682 | CDD:287510 | 10/27 (37%) | ||
C2H2 Zn finger | 691..711 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 719..739 | CDD:275368 | 10/31 (32%) | ||
zf-H2C2_2 | 731..756 | CDD:290200 | 10/55 (18%) | ||
COG5048 | 742..>824 | CDD:227381 | 28/101 (28%) | ||
C2H2 Zn finger | 747..767 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 763..784 | CDD:290200 | 11/20 (55%) | ||
C2H2 Zn finger | 775..795 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 803..818 | CDD:275368 | 5/14 (36%) | ||
C2H2 Zn finger | 831..851 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 859..877 | CDD:275368 | 8/17 (47%) | ||
CG7963 | NP_649798.3 | zf-AD | 10..80 | CDD:285071 | 7/12 (58%) |
C2H2 Zn finger | 159..179 | CDD:275368 | 4/19 (21%) | ||
COG5048 | 184..>250 | CDD:227381 | 22/65 (34%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 245..262 | CDD:275368 | 5/16 (31%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 315..339 | CDD:290200 | 2/6 (33%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BQ0F | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |