DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and CG1603

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster


Alignment Length:487 Identity:118/487 - (24%)
Similarity:195/487 - (40%) Gaps:98/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 AEREAKISNESTESEKSCETDADSCGKSSLY---------------------HEVLSF------- 465
            |.:|....:||:::.....||.|....|..:                     .:|..|       
  Fly   131 AGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRPPRRTRPGQVFKFKVSFIRS 195

  Fly   466 ------ILDAFKRQECLWNP--QHYDYTTCCKTELFRDISVQLQEELNYELSGEECCNEIQKLRT 522
                  ::.|:|...|||||  :||. ....::..:..|..::..:.|...:.||....:::|..
  Fly   196 NPRVLHLIQAYKEHPCLWNPSDEHYQ-DEPARSMAYEAIMERMDRKANVLFTVEELKKTLEQLHV 259

  Fly   523 RYRKELRMVIKHKG-------LYLPKLWCYDEMEFLQ--PILQEQIFNKISKKIGVVGSNQKTKF 578
            :|  .|.:..|.:|       .|..|  |    |||.  |::..:             .|::.. 
  Fly   260 QY--TLALETKQRGKLVGLAARYFAK--C----EFLSVAPVVTPR-------------ENEEDN- 302

  Fly   579 IDASSIRFDNTEKQL---QFVEIYHNYSALWDVDHPDFRSNTYRSQALGQMLDEINTTFHTSYT- 639
             |.::|:.:..|:.|   .|:|.|.||..|::...|||.|...|:.|..:|..|.......:.| 
  Fly   303 -DLTAIKLNFKEENLITTSFIETYANYPVLYNQALPDFGSIEIRADAFKRMAKEFQPVVKANETD 366

  Fly   640 ----AEQLEKTLFNLRKEFSAQKRKILTESEDSSSIPLLHAKLAEFLDQNLGPFR--------CD 692
                ..:|.:.|::..:..   |.|.|.:......:..|  ::..||     |.:        ||
  Fly   367 VYIAVNKLRRWLYDAIRRL---KSKELIQKCSKQEVQYL--QMCSFL-----PAKGSESQVLYCD 421

  Fly   693 ICSDLVKTCDQYKVH-RSAHD-GTQPFICTLCGKGFQMPCNLTVHIRRHRRDFPYSCEQCDKRFA 755
            .|..........:|| ..||: |..|::|:.|.:.|....::..|..|...:....|:.|:|.||
  Fly   422 YCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLRSHFERKLKCQYCEKSFA 486

  Fly   756 TSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIH-RRRHLNQSTFHCPICAKGFYEKNRFTDH 819
            ..|::.:|...||||||::||:|||:|:.....|.| ...|||...:.|.:|.|.|.:|....:|
  Fly   487 VDTDLKVHTLIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANH 551

  Fly   820 MNSHWAIRKHLCTVCGKTFTTYGNLKKHTELH 851
            :..|..||...|..|..||..:.:|.:|...|
  Fly   552 IKGHLNIRDKKCEYCDATFYDHSSLSRHRRSH 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510 23/107 (21%)
MADF_DNA_bdg 595..682 CDD:287510 21/91 (23%)
C2H2 Zn finger 691..711 CDD:275368 5/20 (25%)
C2H2 Zn finger 719..739 CDD:275368 4/19 (21%)
zf-H2C2_2 731..756 CDD:290200 6/24 (25%)
COG5048 742..>824 CDD:227381 30/82 (37%)
C2H2 Zn finger 747..767 CDD:275368 7/19 (37%)
zf-H2C2_2 763..784 CDD:290200 13/20 (65%)
C2H2 Zn finger 775..795 CDD:275368 8/20 (40%)
C2H2 Zn finger 803..818 CDD:275368 5/14 (36%)
C2H2 Zn finger 831..851 CDD:275368 6/19 (32%)
C2H2 Zn finger 859..877 CDD:275368
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 22/93 (24%)
GT1 321..408 CDD:304916 21/91 (23%)
C2H2 Zn finger 420..441 CDD:275368 5/20 (25%)
COG5048 <424..583 CDD:227381 50/158 (32%)
C2H2 Zn finger 450..471 CDD:275368 5/20 (25%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
zf-H2C2_2 490..513 CDD:290200 12/22 (55%)
C2H2 Zn finger 506..527 CDD:275368 8/20 (40%)
C2H2 Zn finger 535..555 CDD:275368 6/19 (32%)
C2H2 Zn finger 563..583 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012671
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.