DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and sna

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:190 Identity:53/190 - (27%)
Similarity:80/190 - (42%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 SEDSSSIPLLHAKLAEFLDQNLGPFRCDICSDLVKTCDQYKVHRSAHDGTQPFICTLCGKGFQMP 729
            |..|:|:...|||...        |:||.|..:..|......||..|       |...      .
  Fly   229 SASSASVAANHAKNYR--------FKCDECQKMYSTSMGLSKHRQFH-------CPAA------E 272

  Fly   730 CNLTVHIRRHRRDFPYSCEQCDKRFATSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRR 794
            ||        :....:|||:|.|.:.|...:.:|:||||  .|..|.:|||:|........|.|.
  Fly   273 CN--------QEKKTHSCEECGKLYTTIGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRT 327

  Fly   795 HLNQSTFHCPICAKGFYEKNRFTDHMNSHWAIRKHLCTVCGKTFTTYGNLKKHTELHLAV 854
            |..:..|.||.|.:.|.:::....|..:|..::|:.|.||.|:|:....|.||:..:..:
  Fly   328 HTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKHSSSNCTI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510
MADF_DNA_bdg 595..682 CDD:287510 6/16 (38%)
C2H2 Zn finger 691..711 CDD:275368 6/19 (32%)
C2H2 Zn finger 719..739 CDD:275368 3/19 (16%)
zf-H2C2_2 731..756 CDD:290200 6/24 (25%)
COG5048 742..>824 CDD:227381 26/81 (32%)
C2H2 Zn finger 747..767 CDD:275368 7/19 (37%)
zf-H2C2_2 763..784 CDD:290200 11/20 (55%)
C2H2 Zn finger 775..795 CDD:275368 7/19 (37%)
C2H2 Zn finger 803..818 CDD:275368 4/14 (29%)
C2H2 Zn finger 831..851 CDD:275368 8/19 (42%)
C2H2 Zn finger 859..877 CDD:275368
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..344 CDD:290200 7/22 (32%)
zf-C2H2 334..356 CDD:278523 6/21 (29%)
C2H2 Zn finger 336..356 CDD:275368 5/19 (26%)
zf-H2C2_2 348..373 CDD:290200 8/24 (33%)
C2H2 Zn finger 364..380 CDD:275368 6/15 (40%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-C2H2 306..328 CDD:278523 7/21 (33%)
COG5048 307..>356 CDD:227381 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.