DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgr and CG18262

DIOPT Version :9

Sequence 1:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:467 Identity:114/467 - (24%)
Similarity:180/467 - (38%) Gaps:114/467 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 YH-----EVLSFILDAFKRQECL---------WNPQHY-------DYTTCCKTELFRD------I 496
            ||     ||| |...|.....||         ..|:|:       ..::.|..||..|      :
  Fly    14 YHNLRCGEVL-FSAPASYEVSCLLCDQRLPLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQDVV 77

  Fly   497 SVQLQEELNYELSGEECCNEIQKLRTRYRKELRMVIKHKGLYLPKLWCYDEMEFLQPILQEQIFN 561
            .||..|||:.||:.|                                       ..|.|:|:   
  Fly    78 EVQGNEELHEELAKE---------------------------------------ASPDLEEE--- 100

  Fly   562 KISKKIGVVGSNQKTKFIDASSIRFDNTEKQLQFVEIYHNYSALWDVDHPDFRSNTYRSQALGQM 626
            :..|:.|    :::..:..|::::....|.:...::|..:::.....:|     |....:..|:.
  Fly   101 EEEKEEG----SKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQSEH-----NETHEEEEGES 156

  Fly   627 LD----EINTTFHTSYTAEQLEKTLFNLRKEFSAQKRKILTESEDSSSIPLLHAKLAEFLDQNL- 686
            .|    :.|.|....:..:|.::. :|.::...:.:|...:|:...|            ||::. 
  Fly   157 DDDDTKDSNDTKDMLFQCDQCDRA-YNTKRSLQSHRRLKHSEANGGS------------LDKSAS 208

  Fly   687 --------GP---FRC--DICSDLVKTCDQYKVHRSAHDGTQPFICTLCGKGFQMPCNLTVHIRR 738
                    ||   ::|  :.|:...:|....:.||..|.|   ..|.:|||.|....|:..|.:|
  Fly   209 ERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKPFTQSGNMMRHRQR 270

  Fly   739 HRRDFPYSCEQCDKRFATSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHC 803
            |....|:.|.:||..|.|..|::.|...|||..|.||::||:..:.......|.|||..:....|
  Fly   271 HSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKC 335

  Fly   804 PICAKGFYEKNRFTDHMNSHWAIRKHLCTVCGKTFTTYGNLKKHTELHLAVKKYKCGTCGKRFAQ 868
            .:|.|.||..:....|..||..:|..:|.|||.||.....|:.|..||...:||.|..|||.|||
  Fly   336 EVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQ 400

  Fly   869 FASLRWHKKREH 880
            ...|..| .|.|
  Fly   401 SGGLNAH-MRSH 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510 18/107 (17%)
MADF_DNA_bdg 595..682 CDD:287510 12/90 (13%)
C2H2 Zn finger 691..711 CDD:275368 5/21 (24%)
C2H2 Zn finger 719..739 CDD:275368 7/19 (37%)
zf-H2C2_2 731..756 CDD:290200 9/24 (38%)
COG5048 742..>824 CDD:227381 27/81 (33%)
C2H2 Zn finger 747..767 CDD:275368 7/19 (37%)
zf-H2C2_2 763..784 CDD:290200 9/20 (45%)
C2H2 Zn finger 775..795 CDD:275368 5/19 (26%)
C2H2 Zn finger 803..818 CDD:275368 5/14 (36%)
C2H2 Zn finger 831..851 CDD:275368 8/19 (42%)
C2H2 Zn finger 859..877 CDD:275368 9/17 (53%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 58/157 (37%)
zf-H2C2_2 263..288 CDD:290200 9/24 (38%)
C2H2 Zn finger 279..327 CDD:275368 17/47 (36%)
zf-H2C2_2 320..342 CDD:290200 7/21 (33%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-C2H2 389..411 CDD:278523 11/22 (50%)
C2H2 Zn finger 391..411 CDD:275368 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.