DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8736 and SUPT5H

DIOPT Version :10

Sequence 1:NP_610394.2 Gene:CG8736 / 35841 FlyBaseID:FBgn0033308 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_003160.2 Gene:SUPT5H / 6829 HGNCID:11469 Length:1087 Species:Homo sapiens


Alignment Length:168 Identity:47/168 - (27%)
Similarity:61/168 - (36%) Gaps:39/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PQHQPAAQYPA--GVNPQDCPNFP---------ICDNARLHNPQPQWGAPQPQW-------NPQP 64
            |.|. .::.||  |....:.||.|         ..|:....:||...|.|.||.       :||.
Human   807 PLHD-GSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQV 870

  Fly    65 QPQWNPQP-------QWQQPQPQWNPQPQPQWQAQPSWNAAPAAAPGGDKY-----PAGVNPQTC 117
            .||:|||.       ...|..|...|.||..:|..||..:....||....|     ||..:|...
Human   871 NPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPS 935

  Fly   118 PNYPYCDVNAGHAGAPVAAPPL-PGWTERLYPAGVSPH 154
            |    ....|..:.:||...|: ||...   |.|.:||
Human   936 P----MAYQASPSPSPVGYSPMTPGAPS---PGGYNPH 966

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8736NP_610394.2 CPCFC 108..124 CDD:375060 5/20 (25%)
SUPT5HNP_003160.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
Spt5_N <93..172 CDD:463406
Interaction with SUPT4H1 176..270
NGN_Euk 178..265 CDD:193577
KOW_Spt5_1 276..313 CDD:240505
Interaction with RNA polymerase II 313..420
UBR5-degron. /evidence=ECO:0000269|PubMed:37478862 328..334
KOW_Spt5_2 420..470 CDD:240506
KOW_Spt5_3 471..521 CDD:240507
KOW_Spt5_4 597..639 CDD:240508
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 670..700
KOW_Spt5_5 702..751 CDD:240509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..978 47/168 (28%)
9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ], motif CTR1 754..817 3/10 (30%)
CTD 772..889 CDD:215026 22/82 (27%)
PHA03269 825..>970 CDD:165527 42/149 (28%)
10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y, motif CTR2 844..950 31/109 (28%)
KOW_Spt5_6 1028..1084 CDD:240510
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.