DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8736 and Supt5

DIOPT Version :10

Sequence 1:NP_610394.2 Gene:CG8736 / 35841 FlyBaseID:FBgn0033308 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_038704.1 Gene:Supt5 / 20924 MGIID:1202400 Length:1082 Species:Mus musculus


Alignment Length:168 Identity:47/168 - (27%)
Similarity:61/168 - (36%) Gaps:39/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PQHQPAAQYPA--GVNPQDCPNFP---------ICDNARLHNPQPQWGAPQPQW-------NPQP 64
            |.|. .::.||  |....:.||.|         ..|:....:||...|.|.||.       :||.
Mouse   801 PLHD-GSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQV 864

  Fly    65 QPQWNPQP-------QWQQPQPQWNPQPQPQWQAQPSWNAAPAAAPGGDKY-----PAGVNPQTC 117
            .||:|||.       ...|..|...|.||..:|..||..:....||....|     ||..:|...
Mouse   865 NPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPS 929

  Fly   118 PNYPYCDVNAGHAGAPVAAPPL-PGWTERLYPAGVSPH 154
            |    ....|..:.:||...|: ||...   |.|.:||
Mouse   930 P----MAYQASPSPSPVGYSPMTPGAPS---PGGYNPH 960

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8736NP_610394.2 CPCFC 108..124 CDD:375060 5/20 (25%)
Supt5NP_038704.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88
Spt5_N <91..170 CDD:463406
Interaction with SUPT4H1 and SUPT4H2. /evidence=ECO:0000250 174..268
NGN_Euk 176..263 CDD:193577
KOW_Spt5_1 274..311 CDD:240505
Interaction with RNA polymerase II. /evidence=ECO:0000250 311..418
UBR5-degron. /evidence=ECO:0000250|UniProtKB:O00267 326..332
KOW_Spt5_2 418..468 CDD:240506
KOW_Spt5_3 469..519 CDD:240507
KOW_Spt5_4 595..637 CDD:240508
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 669..694
KOW_Spt5_5 696..745 CDD:240509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..972 47/168 (28%)
9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ], motif CTR1 748..811 3/10 (30%)
CTD 766..883 CDD:215026 22/82 (27%)
PHA03269 819..>964 CDD:165527 42/149 (28%)
10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y, motif CTR2 838..944 31/109 (28%)
KOW_Spt5_6 1022..1079 CDD:240510
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.