DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42326 and qsm

DIOPT Version :10

Sequence 1:NP_001286200.1 Gene:CG42326 / 35838 FlyBaseID:FBgn0259226 Length:1376 Species:Drosophila melanogaster
Sequence 2:NP_652049.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:63 Identity:15/63 - (23%)
Similarity:29/63 - (46%) Gaps:13/63 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TVDNQLVSARNDCFERIALEAMLPFEKTFRTEDTNSLKMCKEKCLQAGEKC--QAISFGVHRR 93
            |:|..::||:...|:         |..:...:...::.:|.:|||  |.:|  ..:.||..:|
  Fly   258 TIDGDILSAKFKAFK---------FPDSSYVQFRATVNVCLDKCL--GTQCSNNQVGFGRRKR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42326NP_001286200.1 PAN_AP 44..>104 CDD:214680 11/52 (21%)
PHA03247 <224..416 CDD:223021
PAN_AP_HGF 468..560 CDD:238532
PAN_AP_HGF 870..953 CDD:238532
PAN_AP_HGF 984..1070 CDD:238532
qsmNP_652049.1 ZP 30..298 CDD:214579 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.