DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP96A8

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:431 Identity:89/431 - (20%)
Similarity:183/431 - (42%) Gaps:66/431 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TFMTKSLFIMDLEL--------IRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFLDGPEWR-WLR 129
            ||..|..:.:.:::        |..||..:||::....:||.: .:.....::..|...|| |  
plant    74 TFQFKGPWFVGMDVLATVDPANIHHIMSSNFSNYIKGPIFHEI-FEAFGDGIINTDAELWRDW-- 135

  Fly   130 QNLTQV---------FTSGKMKFMFPNMVEVGEKLTQACRLQVGE---IEAKDLCARFTTDVIGS 182
            :|.:|:         |::...|      .:|.:.|.........|   ::.:|:..||..|:...
plant   136 RNASQLIFNHQRYQNFSASTTK------TKVNDGLVPLFNHFANEEIVVDLEDVFQRFMYDITFI 194

  Fly   183 CAFGLECNSL--QDPESQFRRMGRSVTQEPLHSVLVQAFMF-AQPELARKLRFRLFRPEVSEFFL 244
            ...|.:..||  :.||.:|.:....|....:|..:...|:: .|..:......::.:...:   .
plant   195 FITGTDPRSLSIEMPEVEFSKALDDVGDAIVHRHITPRFVWKLQKWIGIGTEKKMLKAHAT---F 256

  Fly   245 DTVRQTLDYRRRE-----------NIHRNDLIQLLMELGEEGVKDALSFEQIAAQ--------AL 290
            |.|.:.:...:||           |..|.||:...::|      ||..:|.:...        .:
plant   257 DRVCEKIIAAKREELGSQGITYNSNGEREDLLTSFIKL------DATKYEVLKPSHDKFLRDFTI 315

  Fly   291 VFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDS-VQEMPYLDQVVAET 354
            .|..||.|::::|:::..:.|:.||:|..::..|:...|.|........| :.::.||...::|:
plant   316 GFMAAGRDSTASTLTWFFWNLSKNPNVLTKILQEINTNLPRTGSDQDMSSYLNKLVYLHGALSES 380

  Fly   355 LRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELY-PDPEKFDPSRFEPEEIK 418
            :|.||.:|...:...||..:|:.:.: :....|:|.::::.....:: .|..:|.|.|:..|...
plant   381 MRLYPPIPFQRKSPIKEDVLPSGHKV-KSNINIMIFIYAMGRMKTIWGEDAMEFKPERWISETGG 444

  Fly   419 ARH--PFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFK 457
            .||  .:.:|.|..|||.|:|:......:|..:|.:|::::
plant   445 VRHEPSYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 89/431 (21%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 89/431 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.