DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP705A5

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_199610.1 Gene:CYP705A5 / 834850 AraportID:AT5G47990 Length:511 Species:Arabidopsis thaliana


Alignment Length:370 Identity:92/370 - (24%)
Similarity:170/370 - (45%) Gaps:66/370 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 KFMFPNMVE--VGEKLTQACR------------------LQVGEIEAKDLCARFTTDVIGSCAFG 186
            |||...||:  :|.:..|..|                  ::...:|.::...:.|.:.|.....|
plant   136 KFMKKFMVQKLLGPQALQRSRNIRADELERFYKTLLDKAMKKQTVEIRNEAMKLTNNTICKMIMG 200

  Fly   187 LECNSLQDPESQFRR--MGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPE---VSEFFLDT 246
            ..| |.::.|::..|  :..|:.....|.:   ..||.:|  .:||...||..|   ||..|.:.
plant   201 RSC-SEENGEAETVRGLVTESIFLTKKHFL---GAMFHKP--LKKLGISLFAKELMNVSNRFDEL 259

  Fly   247 VRQTL---DYRRRENIHRNDLIQLLME-LGEEGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFC 307
            :.:.|   :.:.:|:...:|::.:|:| .|:|..:..::.:||.:..:..|.||.:.|:.|:.:.
plant   260 LEKILVEHEEKLQEHHQTSDMLDMLLEAYGDENAEYKITRDQIKSLFVDLFSAGTEASANTIQWT 324

  Fly   308 LYELALNPDVQERLRVEVLAVLKRNNQKLTYDS-VQEMPYLDQVVAETLRKYPILPHLLRRSTKE 371
            :.|:..||.:.||||.|:.:|:.:.  :|..:: :..:|||..:|.|.||.:|  |..:.|:.||
plant   325 MAEIIKNPKICERLREEIDSVVGKT--RLVQETDLPNLPYLQAIVKEGLRLHP--PGPVVRTFKE 385

  Fly   372 ------YQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRF------EPEEIKARHPFA 424
                  :.||..       :::.:.|::|..||:.:.|||:|.|.||      ..|:.|......
plant   386 TCEIKGFYIPEK-------TRLFVNVYAIMRDPDFWEDPEEFKPERFLASSRLGEEDEKREDMLK 443

  Fly   425 YLPFGEGPRNCIGERFGKLQV--KVGLV-----YLLRDFKFSRSE 462
            |:|||.|.|.|.|.......|  .:|::     ::::..|.:..|
plant   444 YIPFGSGRRACPGSHLAYTVVGSVIGMMVQHFDWIIKGEKINMKE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 92/370 (25%)
CYP705A5NP_199610.1 CYP93 75..504 CDD:410748 92/370 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.