DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP96A13

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_195910.1 Gene:CYP96A13 / 831752 AraportID:AT5G02900 Length:480 Species:Arabidopsis thaliana


Alignment Length:552 Identity:121/552 - (21%)
Similarity:209/552 - (37%) Gaps:147/552 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIYR---- 61
            |.::.:...::.:..::.|.:....|         ||.  |.:.||..:.|      |||.    
plant     1 MASISLFEASIAIFCFIILHFFLGNW---------PVL--GMLPGLLLEFH------RIYDFSVE 48

  Fly    62 ---------KFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNL 117
                     .|:|     .:||.| ..||.:|...|..||..:||::.....|..|.|....|.|
plant    49 VLENSDLTFPFKG-----PWFTGM-DMLFTVDPTNIHHIMSSNFSNYTKGPDFKQVFDVFGDGIL 107

  Fly   118 LFLDGPEWRWLRQ-NLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTD--- 178
            ...|...|:.|:: :|..:...|..|                   ....::.:|:..||..|   
plant   108 TTDDSELWKNLKKASLVMLNHQGFQK-------------------NGTVVDLQDVFKRFMFDTTL 153

  Fly   179 --VIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKL----------R 231
              |.||.  .....|::.||.:|.:....|.:..:|       ...:|.|..||          :
plant   154 VTVTGSA--DPRSLSIEMPEVEFAKALDHVGEGIMH-------RHVRPRLLWKLQKCVGFGQEKK 209

  Fly   232 F----RLFRPEVSEFFL----DTVRQTLDYRRRENIHRN-----DLI-----------QLLMELG 272
            |    .......:::.|    :|..|..||      |.|     |::           :||....
plant   210 FSKADATLNQACAKYILEKREETRSQGFDY------HSNGSESEDILTYHIKIDTTKYELLNPSD 268

  Fly   273 EEGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLT 337
            ::.::|.:         |.|.|||.||:::.:::..:.|..||.|..::|.|:    ..:|....
plant   269 DKFLRDTI---------LAFVLAGRDTTASALTWFFWLLLENPQVVTKIRQEI----NTSNGGQE 320

  Fly   338 YDSVQEMPYLDQVV------AETLRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHH 396
            ..|.:.|.||:.:|      .|.:|.||.:|.......|...:|:.:.: :...||:|.::::..
plant   321 KPSCEPMEYLNNLVYLHGALYEAMRLYPPVPFERMSPIKPDVLPSGHKV-DSSMKILIFIYALGR 384

  Fly   397 DPELY-PDPEKFDPSRFEPEEIKARH--PFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLR--DF 456
            ...:: .|..:|.|.|:..|....||  .|.:|.|..|||:|||::.....:|:.:|.:|:  |.
plant   385 MRAVWGEDASEFKPERWLSETTSLRHEPSFKFLAFNAGPRSCIGKQLAMTLMKIVVVEILQNYDI 449

  Fly   457 KFSRSEKTQIPLKFSSRNFLISTQEGVHLRME 488
            |..:.:|.            |....|..|||:
plant   450 KVVKGQKK------------IEPAPGPILRMK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 113/506 (22%)
CYP96A13NP_195910.1 p450 1..479 CDD:299894 121/552 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.