DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and AT5G08250

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001330676.1 Gene:AT5G08250 / 830721 AraportID:AT5G08250 Length:550 Species:Arabidopsis thaliana


Alignment Length:436 Identity:94/436 - (21%)
Similarity:180/436 - (41%) Gaps:54/436 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFLDGPEWRWLR 129
            |..|:.|.:......:...|...:..::...||.:.....|.....|.|...:...|...|:..|
plant    96 GTFRFRGPWFSTLNCVVTCDPRNVEHLLKTRFSIYPKGSYFRETMQDLLGDGIFNTDDGTWQRQR 160

  Fly   130 QNLTQVFTSGKMKFMFPNMVE--VGEKLTQACRLQVGEIEAKDLCARFTTDVIGSCAFGLE--CN 190
            :..:..|.|.|.:.:....:.  |..:|....... |:|:.:|:..|.|.|.:...|||::  |.
plant   161 KAASVEFHSAKFRQLTSQSLHELVHNRLLPVLETS-GKIDLQDILLRLTFDNVCMIAFGVDPGCL 224

  Fly   191 SLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRF------------------RLFRP 237
            |.:.||..|.:.....|:..:...::..|::   :|.|.|..                  .:.|.
plant   225 SPKLPEIPFAKAFEDATEATVVRFVMPKFVW---KLMRSLNLGTEKKLKESINGVDDFAEEVIRT 286

  Fly   238 EVSEFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEE-GVKDALSFEQIAAQALVFFLAGFDTSS 301
            ...|..|:|          |...|.||:.:.|.|.:| |.|.:..|  :....:.|.|||.||||
plant   287 RKKEMSLET----------EIAKRPDLLTIFMGLRDENGQKFSDKF--LRDICVNFILAGRDTSS 339

  Fly   302 TTMSFCLYELALNPDVQERLRVEVLAVLKR------NNQKLTY------DSVQEMPYLDQVVAET 354
            ..:|:..:.:..||:|:|::.:.:..:|::      ..:.:.|      :.:::|.||...::||
plant   340 VALSWFFWLIEKNPEVEEKIMMGICKILEQRVDHGDTKKNMEYEPVFRPEEIKKMDYLQAALSET 404

  Fly   355 LRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELY-PDPEKFDPSRF-EPEEI 417
            ||.||.:|...:...::...|:... |:.|.|:|..::::.....:: .|..:|.|.|: .....
plant   405 LRLYPSVPVDHKEVLEDDVFPDGTK-LKKGEKVIYAIYAMGRMETIWGKDCREFKPERWLRDGRY 468

  Fly   418 KARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEK 463
            .:...:.:..|..|||.|:|:.|...|::.....::..:|....:|
plant   469 MSESAYKFTAFNGGPRLCLGKDFAYYQMRYVAAAIIYRYKVRVDDK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 94/436 (22%)
AT5G08250NP_001330676.1 CYP86A 98..533 CDD:410687 93/434 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.