DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP705A32

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_188731.1 Gene:CYP705A32 / 821645 AraportID:AT3G20950 Length:526 Species:Arabidopsis thaliana


Alignment Length:424 Identity:105/424 - (24%)
Similarity:174/424 - (41%) Gaps:94/424 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 YCGYFTFM-----TKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFLDGPEWRWL 128
            |..||.||     ||.|....||..|.|...:...|     :.|:.|                  
plant   135 YGDYFKFMRKLIATKLLGPQALERSRKIRADELDRF-----YRNLLD------------------ 176

  Fly   129 RQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTDVIGSCAFGLECNSLQ 193
                         |.|....|::.|:                 .|:...::|.....|..|:  :
plant   177 -------------KAMKKESVDIVEE-----------------AAKLNNNIICKMIMGRSCS--E 209

  Fly   194 DPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPE---VSEF--FLDTVRQTLDY 253
            |.....|..|..:....|...:....:|.:|  .:||...||:.:   ||.|  .|:.:....:.
plant   210 DNGEAERVRGLVIESTALTKQIFLGMIFDKP--LKKLGISLFQKDIKSVSRFDELLEKILVEHEE 272

  Fly   254 RRRENIHRNDLIQLLME-LGEEGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDV 317
            |..::...||::.||:| .|:|..:..::...|.:..:...:||.|||:.|:.:.:.||..||::
plant   273 RMGKHYKANDMMDLLLEAYGDENAEYKITRNHIKSLFVDLVIAGTDTSAQTIEWTMAELINNPNI 337

  Fly   318 QERLRVEVLAVLKRNNQKLTYDS-VQEMPYLDQVVAETLRKYPILPHLLRR-----STKEYQIPN 376
            .||||.|:.:|:  .|.:|..:: :..:|||..||.|.||.:|.....||.     ..|.:.||.
plant   338 LERLREEIESVV--GNTRLVQETDLPNLPYLQAVVKEGLRLHPPGAVFLRTFQERCELKGFYIPE 400

  Fly   377 SNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRF-------EPEEIKARHPFAYLPFGEGPRN 434
            ..|       :::.|::|..||:|:.|||:|.|.||       :.:||: .....|:||..|.|.
plant   401 KTL-------LVVNVYAIMRDPKLWEDPEEFKPERFIASSRSGQEDEIR-EEVLKYMPFSTGRRG 457

  Fly   435 CIGERFGKLQV--KVGLVYLLRDFKFSRSEKTQI 466
            |.|.....:.|  .:|::....|::. :.||..:
plant   458 CPGSNLAYVSVGTAIGVMAQCFDWRI-KGEKVNM 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 105/424 (25%)
CYP705A32NP_188731.1 p450 16..514 CDD:299894 105/424 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.