DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP705A23

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_188649.1 Gene:CYP705A23 / 821557 AraportID:AT3G20140 Length:510 Species:Arabidopsis thaliana


Alignment Length:485 Identity:103/485 - (21%)
Similarity:186/485 - (38%) Gaps:143/485 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GLLLYVKL-RWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIYRKFRG---VER---- 68
            |.|||::: .....:.|...||.|   .|||:           |:|:    .|||   :|.    
plant    75 GPLLYLRIFNVPIIFVSSASVAYE---IFRGH-----------DVNI----SFRGNPPIEESLLV 121

  Fly    69 ---------YCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFLDGPE 124
                     |..|:.||.|   :|..:|:                                 ||:
plant   122 GSFGFFTAPYGDYWKFMKK---VMVTKLL---------------------------------GPQ 150

  Fly   125 ----WRWLRQNLTQVFTSGKM-KFMFPNMVEVGEKLTQ-----ACRLQVGEIEAKDLCARFTTDV 179
                .|.:|.:..:.|....: |.|....||:|::..:     .|::.:|               
plant   151 ALQRSRGIRADALERFYMNLLDKAMKKESVEIGKETMKLIYDSICKMIMG--------------- 200

  Fly   180 IGSCAFGLECNSLQDPESQFRRMGRSVTQE-PLHSVLVQAFMFAQPELARKLRFRLFRPE---VS 240
                      .:..:...:..|:...||:. .|...:..|.:..:|  .:||...||:.|   ||
plant   201 ----------RNFSEENGEAERVRGLVTESTALTKKIFMANVLHKP--LKKLGISLFKKEIMDVS 253

  Fly   241 EFFLDTVRQTL---DYRRRENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFLAGFDTSST 302
            ..|.:.:.:.|   :.:..|:...:.:..||....::..:..::...|.:..:...:||.|||..
plant   254 NSFDELLERFLVEHEEKLNEDQDMDMMGVLLAACRDKNAECKITRNHIKSLFVDLVVAGTDTSRH 318

  Fly   303 TMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDS-VQEMPYLDQVVAETLRKYPILPHLLR 366
            ...:.:.|:...|.|.|::|.|:.:|:.|.  :|..:: :..:|||...|.|.||.:|..| |..
plant   319 ATQWTMAEIINKPKVLEKVREEIYSVVGRT--RLVQETDLPSLPYLQATVKEGLRLHPPGP-LFA 380

  Fly   367 RSTKE------YQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRF--EPEEIKARHPF 423
            |:.:|      :.:|.:       :.:::..:::..||..:.||.:|.|.||  ..:|.:..|..
plant   381 RTAREGFSVGGFYVPEN-------TPLVVNAYAMMRDPGSWEDPNEFKPERFLGSGKEDEREHGL 438

  Fly   424 AYLPFGEGPRNCIGERFGKLQVKVGLVYLL 453
            .|:|||.|.|.|.|         :.|.|:|
plant   439 KYIPFGSGRRGCPG---------INLAYIL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 96/463 (21%)
CYP705A23NP_188649.1 p450 26..504 CDD:386267 103/485 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.