DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP72A14

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:446 Identity:122/446 - (27%)
Similarity:197/446 - (44%) Gaps:72/446 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPL-----TGNLLFLDGPEWRWLRQNLTQVFTS 138
            ::.|||.|.|:::    |:...|   |......||     || |:..||.:|...|:.:...|..
plant   105 TITIMDPEQIKEV----FNKVYD---FQKAHTFPLSKILGTG-LVSYDGDKWAQHRRIINPAFHL 161

  Fly   139 GKMKFMFPNMVEVGEKLTQACRLQVG-------------EIEAKDLCARFTTDVIGSCAFGLECN 190
            .|:|    |||.|   ..::|...||             |::........|.|||...|||    
plant   162 EKIK----NMVHV---FHESCSELVGEWDKLVSDKGSSCEVDVWPGLTSMTADVISRTAFG---- 215

  Fly   191 SLQDPESQFRRMGRSV--TQEPLHSVLVQAFM-FAQP---ELARK--LRFRLFRPEVSEFFLDTV 247
                  |.:|. |..:  .|..|..:::|||. |..|   .|..|  .|.:....|:.:.....:
plant   216 ------SSYRE-GHRIFELQAELAQLVMQAFQKFFIPGYIYLPTKGNRRMKTAAREIQDILRGII 273

  Fly   248 RQTLDYRRRENIHRNDLIQLLME--LGE-EGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFCLY 309
            .:....|........||:.:|:|  ||: ||  :.:|.|.:..:..:|:|||.:|:|..:.:.:.
plant   274 NKRERARESGEAPSEDLLGILLESNLGQTEG--NGMSTEDMMEECKLFYLAGQETTSVLLVWTMV 336

  Fly   310 ELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQI 374
            .|:.:.|.|.|.|.||..|.  .:::...:.:.::..:..::.|.||.||.:..|.|...||.::
plant   337 LLSQHQDWQARAREEVKQVF--GDKQPDTEGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMKL 399

  Fly   375 PNSNLILEPGSKIIIPVHSIHHDPELY-PDPEKFDPSRFEPEEIKA-RHPFAYLPFGEGPRNCIG 437
              .:|.|..|.:|.:||..:|.|.||: .|..:|.|.||:....|| ::..::.||..|||.|||
plant   400 --GDLTLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIG 462

  Fly   438 ERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRNFLIST---QEGVHLRMEGL 490
            :.|..|:.|:.:..:|:.|.|..|.      .:....:.|.|   |.|.||.:..|
plant   463 QNFTLLEAKMAMSLILQRFSFELSP------SYVHAPYTIITLYPQFGAHLMLHKL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 115/427 (27%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 121/444 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.