DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP705A9

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_180269.1 Gene:CYP705A9 / 817243 AraportID:AT2G27010 Length:498 Species:Arabidopsis thaliana


Alignment Length:311 Identity:73/311 - (23%)
Similarity:144/311 - (46%) Gaps:34/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 IEAKDLCARFTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKL 230
            :|..:...:...:.:.....|..| |.::.|:: |..|.....:.|....:.|.:..:|  .:|:
plant   155 VEIAEEAMKLVNNTVCQMIMGRSC-SEENGEAE-RVRGLVTKTDALTKKFILAGILRKP--LQKI 215

  Fly   231 RFRLFRPEVSEF---FLDTVRQTL-DYRRRENIHR--NDLIQLLMEL-GEEGVKDALSFEQIAAQ 288
            ...||:.|:.:.   |.:.:.:.| :|:.:...|.  .|::..|:|: |:|..:..::.:.|.:.
plant   216 GISLFKKELMDASCKFNEVLEKILVEYKEKVEEHHQGTDMMDKLLEVYGDEKAEYKITRDHIKSL 280

  Fly   289 ALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAE 353
            .:..|.||.||.:..:.:.:.|:..|..:.||||.|:.:|:.: .:.:....:..:|.|...|.|
plant   281 FVDLFFAGTDTWTHAIQWIMAEIINNSYILERLREEIDSVVGK-TRLIQETDLPNLPCLQATVKE 344

  Fly   354 TLRKYPILPHLLRRSTKE------YQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRF 412
            .||.:|.:| |:.|:.||      :.:|....::..|       :::..|||.:.||::|.|.||
plant   345 GLRLHPPVP-LVLRTFKEGCTIGGFYVPEKTTLVVNG-------YAMMRDPEYWEDPQEFKPERF 401

  Fly   413 -------EPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDF 456
                   :.:||: .....|||||.|.|.|.|.....:.|...:..:::.|
plant   402 LASSRSSQNDEIR-DELLKYLPFGNGRRACPGANLAYISVGTAIGVMVQCF 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 73/311 (23%)
CYP705A9NP_180269.1 p450 46..486 CDD:299894 73/311 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.