DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and CYP705A8

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:398 Identity:89/398 - (22%)
Similarity:174/398 - (43%) Gaps:73/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NVRDDPLTGNLLFLD---------GPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEK-------- 154
            :.||.|.....|||.         |..|:::::.:.       .|.:.|..:|..::        
plant   105 STRDFPTNEGSLFLGSFSFITAPYGEYWKFMKKLIV-------TKLLGPQALERSQRIRANEVER 162

  Fly   155 -----LTQACRLQVGEIEAKDLCARFTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSV 214
                 |.:|.:.:  .:|..|...:...::|.....|..|:   :...:..|:...||:.   ..
plant   163 FYSNLLDKAMKKE--SVEIADEAMKLVNNIICKMIMGRTCS---EENGEAERIRGLVTKS---DA 219

  Fly   215 LVQAFMFA----QPELARKLRFRLFRP---EVSEFFLDTVRQTL---DYRRRENIHRNDLIQLLM 269
            |::.|:.|    :|  .:|:...||:.   ::|..|.:.:.:.|   :.|..||....|::..|:
plant   220 LLKKFLLAAILRKP--LKKIGITLFKKVFMDISLKFDEVLEKILVENEERLEENQQGTDIMDKLL 282

  Fly   270 EL-GEEGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNN 333
            |: |::..:..::.:.|.:..:..|.||.||::.|:.:.:.|:..|..:.||||.|:.:|:.: .
plant   283 EVYGDKTSEYKITRDHIKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGK-T 346

  Fly   334 QKLTYDSVQEMPYLDQVVAETLRKYPILPHLLRR-----STKEYQIPNSNLILEPGSKIIIPVHS 393
            :.:....:..:.||...|.|.||.:|.:|.:||.     :...:.||..       :|:::..::
plant   347 RLIQETDLPNLLYLQATVKEGLRLHPTIPLVLRTFQDGCTIGGFSIPKK-------TKLVVNGYA 404

  Fly   394 IHHDPELYPDPEKFDPSRF-------EPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVK--VGL 449
            |..||:.:.||.:|.|.||       :.:.|| .....||.||.|.|.|.|.....:.|:  :|:
plant   405 IMRDPDNWEDPLEFKPERFLASSRSSQKDAIK-EEVLKYLSFGSGRRGCPGVNLAYVSVETAIGV 468

  Fly   450 VYLLRDFK 457
            :....|:|
plant   469 MVQCFDWK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 89/398 (22%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 89/398 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.