DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and shd

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster


Alignment Length:412 Identity:88/412 - (21%)
Similarity:157/412 - (38%) Gaps:92/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GPEWRWLRQNLTQVFTSGK-MKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTDVIGSCAF 185
            ||.|:.||.:||...||.: ::...|.:..|.:...:..|            ||...|.:....|
  Fly   163 GPMWQRLRSSLTSSITSPRVLQNFLPALNAVCDDFIELLR------------ARRDPDTLVVPNF 215

  Fly   186 -------GLE--CNSLQDPESQFRRMGRSV--TQEP-----LHSVLVQAFMFAQPE-----LARK 229
                   |||  |..:..     ||||...  |::|     |.:.:.|.|:..:..     |.:.
  Fly   216 EELANLMGLEAVCTLMLG-----RRMGFLAIDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKY 275

  Fly   230 LRFRLFR--PEVSEFFLDTVRQTLDYRRRE----------------NIHRNDLIQLLMELGEEGV 276
            ...:.:|  ....:...|.:.:.:|:...|                :|..|     ::||.:..:
  Fly   276 FPTKTYRDFARAEDLIYDVISEIIDHELEELKKSAACEDDEAAGLRSIFLN-----ILELKDLDI 335

  Fly   277 KDALSFEQIAAQALV-FFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDS 340
            :|..|       |:: |..||.:|.:.|:.|.|..:..:|....|:..|.......|   :..|:
  Fly   336 RDKKS-------AIIDFIAAGIETLANTLLFVLSSVTGDPGAMPRILSEFCEYRDTN---ILQDA 390

  Fly   341 VQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPE 405
            :....|....:.|:.|..|....|.|...::.::  |...|..|:.::.......|....:...:
  Fly   391 LTNATYTKACIQESYRLRPTAFCLARILEEDMEL--SGYSLNAGTVVLCQNMIACHKDSNFQGAK 453

  Fly   406 KFDPSRF-----EPEEIKARHPFAYLPFGEGPRNCIGERFGKLQV-----KVGLVY-------LL 453
            :|.|.|:     |...:...:....:|||.|.|:|.|:||.:::|     |:.|.:       |.
  Fly   454 QFTPERWIDPATENFTVNVDNASIVVPFGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVSFVKPLE 518

  Fly   454 RDFKFSRSEKTQIPLKFSSRNF 475
            .:|:|..:.||.:.|:.|.|.|
  Fly   519 TEFEFLLAPKTPLSLRLSDRVF 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 88/412 (21%)
shdNP_001261843.1 p450 63..528 CDD:299894 82/398 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.