DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and erg5

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 / 2542469 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe


Alignment Length:399 Identity:88/399 - (22%)
Similarity:172/399 - (43%) Gaps:72/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NLLFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQ-----------ACRLQVGEIEAK 169
            |.:||||.:....|:.|..:||:..:....|....|..|..:           ...:...:|...
pombe   132 NWVFLDGRDHIEYRKGLNGLFTTRALASYLPAQEAVYNKYFKEFLAHSKDDYAQYMIPFRDINVA 196

  Fly   170 DLCARFTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPEL-ARKLRFR 233
            ..|..|       |.:.:..::::....::.::  :...|.::..:|..|......: :||:..|
pombe   197 TSCRTF-------CGYYISDDAIKHIADEYWKI--TAAMELVNFPIVLPFTKVWYGIQSRKVVMR 252

  Fly   234 LFRPEVSEFFLDTVRQTLDYRRRENIHRNDLIQLLME--------------LGEEGVKD------ 278
            .|....:|             .|:|:...:....:||              ..:||.:.      
pombe   253 YFMKAAAE-------------SRKNMEAGNAPACMMEEWIHEMIETRKYKSENKEGAEKPSVLIR 304

  Fly   279 ALSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRN-NQKLTYDSVQ 342
            ..|.|:|:...|.|..|..|.:|:.|::....||.:|||.:::|.|.|.:.|.: :..|:.|.::
pombe   305 EFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREEQLRIRKGDIDVPLSLDLME 369

  Fly   343 EMPYLDQVVAETLRKYP---ILPHLLRRS---TKEYQIPNSNLILEPGSKIIIP-VHSIHHDPEL 400
            :|.|...||.|.||..|   ::|:.::::   |.:|.:|.        ..::|| ::...||.::
pombe   370 KMTYTRAVVKECLRLRPPVLMVPYRVKKAFPITPDYTVPK--------DAMVIPTLYGALHDSKV 426

  Fly   401 YPDPEKFDPSRFEPEEIKARHPFAYLPFGEGPRNCIGERF--GKLQVKVGLVYLLRDFKFSRSEK 463
            ||:||.|:|.|:.|..:..:.|..::.||.||..|:|:|:  ..|...:|...::.|:|..|:..
pombe   427 YPEPETFNPDRWAPNGLAEQSPKNWMVFGNGPHVCLGQRYAVNHLIACIGKASIMLDWKHKRTPD 491

  Fly   464 TQIPLKFSS 472
            :...:.|::
pombe   492 SDTQMIFAT 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 88/399 (22%)
erg5NP_593788.2 CypX 57..505 CDD:225035 88/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.