DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:209 Identity:54/209 - (25%)
Similarity:101/209 - (48%) Gaps:21/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVFTVGLLLYVKL--RWHYSYWSRRGVAGERPVYFRGNM-------SGLGRDLHWTDINLRIYR 61
            :||..|..::||.|  :..:....:.|::|..|.:..||:       :.||.|..:...| ::::
 Worm     9 ILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDWYN-KLHK 72

  Fly    62 KFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLL---FLDGP 123
            :|.  |.:..||.... ::.|.:.|.|:::.|::||:|:||.....:.|:.|..:||   :..| 
 Worm    73 QFG--ETFGIYFGTQL-NINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYESG- 133

  Fly   124 EWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARF---TTDVIGSCAF 185
             |:..|..:..:|::||||.|...:....:...:..:.:....:..|:...|   |.||||.|||
 Worm   134 -WKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQKWDIYDDFQGLTLDVIGKCAF 197

  Fly   186 GLECNSLQDPESQF 199
            .::.|..:|....|
 Worm   198 AIDSNCQRDRNDIF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 47/180 (26%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 47/181 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.