DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a13 and cest-32

DIOPT Version :9

Sequence 1:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:77 Identity:22/77 - (28%)
Similarity:33/77 - (42%) Gaps:24/77 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 SEFFLDTVRQTLDYRRR------ENIHRND-------LIQLLME----LGE-EGVKDALSFEQIA 286
            |.|..|.|...:|.::|      :||.:||       ||||:.:    :|. |.||.:..:...|
 Worm   352 SSFGSDVVENAVDVQKRIMEFYMKNIDKNDDKAVEKRLIQLISDSWFNIGALETVKTSTKYGSNA 416

  Fly   287 AQALVFFLAGFD 298
                  :|..||
 Worm   417 ------YLGSFD 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 22/77 (29%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 22/77 (29%)
Aes <104..>227 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.