powered by:
Protein Alignment Cyp6a13 and cest-32
DIOPT Version :9
Sequence 1: | NP_610390.1 |
Gene: | Cyp6a13 / 35837 |
FlyBaseID: | FBgn0033304 |
Length: | 493 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_504397.1 |
Gene: | cest-32 / 178909 |
WormBaseID: | WBGene00016862 |
Length: | 545 |
Species: | Caenorhabditis elegans |
Alignment Length: | 77 |
Identity: | 22/77 - (28%) |
Similarity: | 33/77 - (42%) |
Gaps: | 24/77 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 SEFFLDTVRQTLDYRRR------ENIHRND-------LIQLLME----LGE-EGVKDALSFEQIA 286
|.|..|.|...:|.::| :||.:|| ||||:.: :|. |.||.:..:...|
Worm 352 SSFGSDVVENAVDVQKRIMEFYMKNIDKNDDKAVEKRLIQLISDSWFNIGALETVKTSTKYGSNA 416
Fly 287 AQALVFFLAGFD 298
:|..||
Worm 417 ------YLGSFD 422
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cyp6a13 | NP_610390.1 |
p450 |
33..476 |
CDD:278495 |
22/77 (29%) |
cest-32 | NP_504397.1 |
COesterase |
15..516 |
CDD:278561 |
22/77 (29%) |
Aes |
<104..>227 |
CDD:223730 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D264519at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.