DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and ERG5

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_013728.1 Gene:ERG5 / 855029 SGDID:S000004617 Length:538 Species:Saccharomyces cerevisiae


Alignment Length:538 Identity:112/538 - (20%)
Similarity:197/538 - (36%) Gaps:151/538 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FSYWKRKGVPHETPLPIVGN-MRGIVKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLD 86
            |.:|           ||:|. :..:..|:       ..||.....||::.:.:|.|...:.:..|
Yeast    76 FKFW-----------PIIGPFLESLDPKF-------EEYKAKWASGPLSCVSIFHKFVVIASTRD 122

  Fly    87 FIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFA------LEGEEWRAMRHKLTPVFTSGKIKQMS 145
            ..::::        ....|..|....:...:..      |:|:.....|..|..:||...:.|..
Yeast   123 LARKIL--------QSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYL 179

  Fly   146 KVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKG 210
            ..:..:   :...|||.|:.:|  |.|.|                           |...|.:. 
Yeast   180 PSLEQI---MDKYMDKFVRLSK--ENNYE---------------------------PQVFFHEM- 211

  Fly   211 REIFTRRRHSTLVQSFIFTNARLARKLRIKVLPDDLTQFFMSTV-------------------KN 256
            |||......::...::|..:       :::.:.||   :::.|.                   |.
Yeast   212 REILCALSLNSFCGNYITED-------QVRKIADD---YYLVTAALELVNFPIIIPYTKTWYGKK 266

  Fly   257 TVDYRLKNGIKRNDFIEQMIELRAEDQEAA-----------------KKGQGIDLS----HGLTL 300
            |.|..:|       ..|...:: |:|..||                 .|....|.|    ...|.
Yeast   267 TADMAMK-------IFENCAQM-AKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTN 323

  Fly   301 EQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTY 365
            ::::...|.|..|..:.|||........:|.:||:..::|||..:|..|....|||.|::.:|.|
Yeast   324 KEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKY 388

  Fly   366 LDQVLSETLRKHP---LLPHLIRE---TTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPE 424
            .:.|:.||||..|   ::|:::::   .:.:|..|       ||.:.:..::...||||:|..|:
Yeast   389 TNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAP-------KGAMLIPTLYPALHDPEVYENPD 446

  Fly   425 KFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFK-FSVSNRTDVPL- 487
            :|.|.|:......:.....:|.||.||..|:|..:    ..|...:||.:|. ::..:.|..|| 
Yeast   447 EFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTY----VMITFAALLGKFALYTDFHHTVTPLS 507

  Fly   488 --------IFSKKSFLLT 497
                    ||.|...|||
Yeast   508 EKIKVFATIFPKDDLLLT 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 110/529 (21%)
ERG5NP_013728.1 CYP61_CYP710 103..522 CDD:410703 101/488 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.