DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP735A2

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:531 Identity:133/531 - (25%)
Similarity:219/531 - (41%) Gaps:135/531 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIFSYWKRKGVPHETPLPIVGNMRGIVKKY---------------------HFRDINQRIYKKF- 63
            :|..:.:|:|:....|..:.||:..|.|..                     |:...:::..|:| 
plant    35 RIKKFMERQGITGPKPRLLTGNIIDISKMLSHSASNDCSSIHHNIVPRLLPHYVSWSKQYGKRFI 99

  Fly    64 --KGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGH---------- 116
              .|..|          ...:|:.:.||:::.|               .:|:||.          
plant   100 MWNGTEP----------RLCLTETEMIKELLTK---------------HNPVTGKSWLQQQGTKG 139

  Fly   117 -----LFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIK 176
                 |....||.|...||...|.||..::|..:|.:|:....:.:.:.|.|.|      .|||.
plant   140 FIGRGLLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVECTKMMAERLRKEVGE------EVEIG 198

  Fly   177 DLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFT-----RRRHSTLVQSFIFTNARLARK 236
            :...|.|.|:|....||..|:           ||:|:|:     :|..:...:...|..:|    
plant   199 EEMRRLTADIISRTEFGSSCD-----------KGKELFSLLTVLQRLCAQATRHLCFPGSR---- 248

  Fly   237 LRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQ-GIDLSHGLTL 300
                         |:.:..|.....||..::|  .:.::|:.|.:..|..:... |.||. ||.|
plant   249 -------------FLPSKYNREIKSLKTEVER--LLMEIIDSRKDSVEIGRSSSYGDDLL-GLLL 297

  Fly   301 EQMAA------------QAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGG 353
            .||.:            :...||..|.||:|..::..|..||..|..|..:|:|:..|..  ..|
plant   298 NQMDSNKNNLNVQMIMDECKTFFFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQVCG--QDG 360

  Fly   354 ELNYDVLAQMTYLDQVLSETLRKHP---LLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHH 415
            ..:.:.|:.:|.|::|::|:||.:|   |||.:..|     .|...|:::.||:...|||..|||
plant   361 VPSVEQLSSLTSLNKVINESLRLYPPATLLPRMAFE-----DIKLGDLIIPKGLSIWIPVLAIHH 420

  Fly   416 DPEIYPE-PEKFDPSRFDPEE-VKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFS 478
            ..|::.| ..:|:|.||.... ..:||   ::||..|||||||..|..::|||.|..|:.:|.|:
plant   421 SNELWGEDANEFNPERFTTRSFASSRH---FMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFA 482

  Fly   479 VS-NRTDVPLI 488
            :| |....|::
plant   483 ISENYRHAPIV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 130/520 (25%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 133/531 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.