DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP89A7

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_176673.1 Gene:CYP89A7 / 842801 AraportID:AT1G64930 Length:511 Species:Arabidopsis thaliana


Alignment Length:526 Identity:113/526 - (21%)
Similarity:194/526 - (36%) Gaps:149/526 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQ 90
            |.|:|         :|.....|:..|.|            .|||..:.:..:....:.|.....|
plant    47 WLRQG---------LGGFNNYVRSVHHR------------LGPIITLRITSRPAIFVADGSLAHQ 90

  Fly    91 VMIKDFSYFQDRGAFTNPRDDPLTGHL--------FALEGEEWRAMRHKLTPVFTSGKIKQMSKV 147
            .::.:.:.|.||     |...|::..|        ..|.|..||.:|..:|.:....::|..|.|
plant    91 ALVLNGAVFADR-----PPAAPISKILSNNQHTITSCLYGVTWRLLRRNITEILHPSRMKSYSHV 150

  Fly   148 --------------------------------IVDVGLRLGDAMD-KAVKEAKVEE-------GN 172
                                            .|.|.:..||.:| |.:|:.:..:       ..
plant   151 RHWVLEILFDRLRKSGGEEPIVVFDHLHYAMFAVLVLMCFGDKLDEKQIKQVEYVQRQMLLGFAR 215

  Fly   173 VEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIF-TRRRHSTLVQSFIFTNARLA-- 234
            ..|.:||.:||..::                   |::..|.| .||....::...|:...::.  
plant   216 YSILNLCPKFTKLIL-------------------RKRWEEFFQMRREQQDVLLRLIYARRKIVEE 261

  Fly   235 RKLRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLT 299
            ||.|.....::..::..|.|...:|..|.:. ||....::::.|.:|                  
plant   262 RKKRSSEEEEENKEYVQSYVDTLLDVELPDE-KRKLNEDEIVSLCSE------------------ 307

  Fly   300 LEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGE---LNYDVLA 361
                      |.:||.:|:::.:...:..|....:||:||.|||    .||.|.|   :......
plant   308 ----------FLIAGSDTTATVLQWIMANLVKNQEIQERLYEEI----TNVVGEEAKVVEEKDTQ 358

  Fly   362 QMTYLDQVLSETLRKHP----LLPHLIRETT--KDYQIPNSDIVLDKGILALIPVHNIHHDPEIY 420
            :|.||..|:.|.||:||    :|||.:.|.|  ..|::|.      ||.:..: |..|..||:::
plant   359 KMPYLKAVVMEALRRHPPGNTVLPHSVTEDTVLGGYKVPK------KGTINFL-VAEIGRDPKVW 416

  Fly   421 PEPEKFDPSRFDPEE----VKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSN 481
            .||..|.|.||..||    :.....:..:|||.|.|.|.|:....:..:..:.:::|.|::....
plant   417 EEPMAFKPERFMGEEEAVDITGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVREFQWKEVE 481

  Fly   482 RTDVPL 487
            ..:|.|
plant   482 GHEVDL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 110/520 (21%)
CYP89A7NP_176673.1 CYP77_89 65..502 CDD:410698 107/499 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.