DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP97A3

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:484 Identity:118/484 - (24%)
Similarity:203/484 - (41%) Gaps:81/484 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFALEGE 123
            :|:.|...|.|..:....|...:::|....|.: :||.:....:|......|..:...|...:||
plant   132 LYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHI-LKDNAKAYSKGILAEILDFVMGKGLIPADGE 195

  Fly   124 EWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIG 188
            .||..|..:.|......:..|..:..:...||...:|.|.  .|.||  ||::.|.:|.|.|:||
plant   196 IWRRRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAA--LKGEE--VEMESLFSRLTLDIIG 256

  Fly   189 SCAFGLECNSLQDPS------------AEFRQKG----------REIFTRRRHSTLVQSFIFTNA 231
            ...|..:.:||.:.:            ||.|...          ::|..|:|             
plant   257 KAVFNYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQR------------- 308

  Fly   232 RLARKLRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSH 296
            ::|..|:   |.:|.....::|.|..|:.      :...|.|:.:..|...........|.|:|.
plant   309 KVATSLK---LINDTLDDLIATCKRMVEE------EELQFHEEYMNERDPSILHFLLASGDDVSS 364

  Fly   297 GLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLA 361
                :|:........:||.|||::.::...|.|..:|.:..:|:||::||:.:      .:..:.
plant   365 ----KQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVIGD------RFPTIQ 419

  Fly   362 QM---TYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSDIV----LDKGILALIPVHNIHHDPEI 419
            .|   .|..:|::|:||.:|..|.|||.:.      ::||:    :.:|....|.|.|:|..|..
plant   420 DMKKLKYTTRVMNESLRLYPQPPVLIRRSI------DNDILGEYPIKRGEDIFISVWNLHRSPLH 478

  Fly   420 YPEPEKFDPSRF-----DPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSV 479
            :.:.|||:|.|:     :|.|....  .:|||||.|||.|||..|...:..:.:..|:|||.|.:
plant   479 WDDAEKFNPERWPLDGPNPNETNQN--FSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQI 541

  Fly   480 SNRTDVPLIFSKKSFLLTTNDGIYLKVER 508
            :  ...|.:.......:.|.:|:.|.|.:
plant   542 A--PGAPPVKMTTGATIHTTEGLKLTVTK 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 117/480 (24%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 118/484 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.