DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:282 Identity:58/282 - (20%)
Similarity:100/282 - (35%) Gaps:79/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VPHETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKD 95
            |.|..|||:..:....:..:....:.:...|.|...||...:        ::.|.:.::::|.| 
plant    67 VAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNV--------IVMDPETLREIMSK- 122

  Fly    96 FSYFQDRGAFTNPRDDPLTGH-------LFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGL 153
                  ...|..|:   :..|       |...||.:|...|..|.|.|   :|..:..::     
plant   123 ------HELFPKPK---IGSHNHVFLSGLLNHEGPKWSKHRSILNPAF---RIDNLKSIL----- 170

  Fly   154 RLGDAMDKAVKEAKVE-------EGNVEIKDL--CARFTTDVIGSCAFGLECNSLQDPSAEFRQK 209
               .|.:.:.||...|       :|.:|:...  |...|.:::...:||   :|.:|        
plant   171 ---PAFNSSCKEMLEEWERLASAKGTMELDSWTHCHDLTRNMLARASFG---DSYKD-------- 221

  Fly   210 GREIFTRRRHSTLVQSFIFTNARLARKLRI---KVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDF 271
            |.:||      .:.|..|.......|.:.|   |.||   |:|.....:...|.|.        .
plant   222 GIKIF------EIQQEQIDLGLLAIRAVYIPGSKFLP---TKFNRRLRETERDMRA--------M 269

  Fly   272 IEQMIELRAEDQEAAKKGQGID 293
            .:.|||.:   :|..|:|:|.|
plant   270 FKAMIETK---EEEIKRGRGTD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 57/281 (20%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.