DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP715A1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_200053.2 Gene:CYP715A1 / 835316 AraportID:AT5G52400 Length:519 Species:Arabidopsis thaliana


Alignment Length:478 Identity:118/478 - (24%)
Similarity:201/478 - (42%) Gaps:101/478 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLDFI----KQVMI 93
            |...||            ||....|...|.|.       .::..:....:.|.:|:    |.|:.
plant    87 HSIALP------------HFARWQQEYGKVFV-------YWLGIEPFVYVADPEFLSVMSKGVLG 132

  Fly    94 KDFS----YFQDRGAFTNPRDDPLTG-HLFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGL 153
            |.:.    :.:||        :|:.| .|..:||::|...||.:||.|....:|.|:.::|:   
plant   133 KSWGKPNVFKKDR--------EPMFGTGLVMVEGDDWTRHRHIITPAFAPLNLKVMTNMMVE--- 186

  Fly   154 RLGDAMDKAVKEAKVEEGNVEIKDLCARF---TTDVIGSCAFGLECNSLQDPSAEFRQKGREIFT 215
            .:.:.:|:  ...::..||.|. |:.:..   ..::|...:||:.           .:.|.::..
plant   187 SVSNMLDR--WGIQINSGNPEF-DMESEIIGTAGEIIAKTSFGVT-----------GENGTQVLK 237

  Fly   216 RRRHSTLVQSFIFTNARLARKLRIKVLPDDLTQFFMSTVK-----NTVDYRLKNGIKRNDFIEQM 275
            ..|   .||..:|.:.|...      :|......:..|||     :.:|..|.:.|.:     :.
plant   238 NLR---AVQFALFNSNRYVG------VPFSNILSYKQTVKAKGLGHEIDGLLLSFINK-----RK 288

  Fly   276 IELRAEDQEAAKKGQGIDL---------SHGLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELAL 331
            |.|...|.      ||.||         ....|.:::..:...||.||.||::..::.....||:
plant   289 ISLAEGDD------QGHDLLGMLLKADQKGNFTAKELVDECKTFFFAGHETTALALTWTFMLLAI 347

  Fly   332 QPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNS 396
            .|:.|..:||||..|:.:   .::.|:.||.:..:..|::|.||.:|..|:..|:...|.::  :
plant   348 HPEWQDTIREEIREVIGD---SKIEYNKLAGLKKMSWVMNEVLRLYPPAPNAQRQARNDIEV--N 407

  Fly   397 DIVLDKGILALIPVHNIHHDPEIY-PEPEKFDPSRFDPE---EVKNRHPMAYLPFGDGPRNCIGL 457
            ..|:..|....|.|..:|||.|:: .:..:|.|.|||..   ..||:  |.|:|||.|.|.|||.
plant   408 GRVIPNGTNIWIDVVAMHHDVELWGDDVNEFKPERFDGNLHGGCKNK--MGYMPFGFGGRMCIGR 470

  Fly   458 RFGKIQAKIGLVSLLRRFKFSVS 480
            ....::.||.|..:|.||:.|||
plant   471 NLTTMEYKIVLSLVLSRFEISVS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 118/478 (25%)
CYP715A1NP_200053.2 p450 16..519 CDD:299894 118/478 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.