DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP709B3

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:506 Identity:121/506 - (23%)
Similarity:229/506 - (45%) Gaps:55/506 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKY----------HFRDI 55
            :||.::.:.....:.....:.:...:|::|:.......:.||:..|.|..          :..||
plant    15 LLFVVSKIWKACWILLLRPLMLSKRFKKQGISGPKYKILYGNLSEIKKMKKEADLCVLDPNSNDI 79

  Fly    56 NQRIYKKF-KGQGPIAGMYMFF---KRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGH 116
            ..|::.:: :........::|:   |.|..|::.:..|||:...|      |....|...|....
plant    80 FPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKF------GFTIIPVKRPEVFI 138

  Fly   117 LFA-----LEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIK 176
            ||.     ::|::|...|..|.|.|:..::|.|::.:.|..||:.:...|..:..:|.. .:||.
plant   139 LFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQRRNGEVLI-KIEIS 202

  Fly   177 DLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIKV 241
            ....:.|.|:|.:.|||    |......|..:...|: .:...|:|...||.....|.....:|:
plant   203 KEFHKLTADIIATTAFG----SSYAEGIELCRSQTEL-EKYYISSLTNVFIPGTQYLPTPTNLKL 262

  Fly   242 LPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIEL---RAEDQEAAKKGQGIDLSHGLTLEQM 303
            .  :|.:...:::|..:|.|||:..|...:.:.::.:   .|:..|..:|         :.::::
plant   263 W--ELHKKVKNSIKRIIDSRLKSKCKTYGYGDDLLGVMLTAAKSNEYERK---------MRMDEI 316

  Fly   304 AAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGEL--NYDVLAQMTYL 366
            ..:...|:.||..|:|..::.....|:|....|::||||:    .|..|.:.  :.|..:::..:
plant   317 IEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEV----FNECGKDKIPDTDTFSKLKLM 377

  Fly   367 DQVLSETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPE-PEKFDPSR 430
            :.||.|:||.:..:..:.||.|:|.::.:.:|  .||...:||:..:|.|..|:.| .|:|:|.|
plant   378 NMVLMESLRLYGPVIKISREATQDMKVGHLEI--PKGTSIIIPLLKMHRDKAIWGEDAEQFNPLR 440

  Fly   431 FDPE-EVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVS 480
            |:.. .....||.|.|||..|||.||...|..::||..|..:|::|:.|:|
plant   441 FENGISQATIHPNALLPFSIGPRACIAKNFAMVEAKTVLTMILQQFQLSLS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 117/475 (25%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 121/506 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.