DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP705A32

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188731.1 Gene:CYP705A32 / 821645 AraportID:AT3G20950 Length:526 Species:Arabidopsis thaliana


Alignment Length:481 Identity:114/481 - (23%)
Similarity:199/481 - (41%) Gaps:114/481 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALI 82
            ||:::|          ..|:.:..:.....:.:..:|:|    ...:|..| ||..:.|..:   
plant    82 LHLRVF----------HVPIVLASSASVAYEIFKAQDVN----VSSRGHAP-AGESLLFGSS--- 128

  Fly    83 TDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFALEGEEWRAMRHKL-TPVFTSGKIKQMSK 146
                          |:|                  ||..|:.::.||..: |.:.....:::..|
plant   129 --------------SFF------------------FAPYGDYFKFMRKLIATKLLGPQALERSRK 161

  Fly   147 VIVDVGLRL-GDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKG 210
            :..|...|. .:.:|||:|:.     :|:|.:..|:...::|.....|..|:  :|.....|.:|
plant   162 IRADELDRFYRNLLDKAMKKE-----SVDIVEEAAKLNNNIICKMIMGRSCS--EDNGEAERVRG 219

  Fly   211 REIFTRRRHSTLVQSFIFTNA---RLARKLRIKVLPDDL---TQFFMSTVKNTVDY--RLKNGIK 267
            ..|     .||.:...||...   :..:||.|.:...|:   ::|.....|..|::  |:....|
plant   220 LVI-----ESTALTKQIFLGMIFDKPLKKLGISLFQKDIKSVSRFDELLEKILVEHEERMGKHYK 279

  Fly   268 RNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFV-FFVAGFETSSSTMSLCLYELAL 331
            .||.::.::|...::....|    |..:|..:|       || ..:||.:||:.|:...:.||..
plant   280 ANDMMDLLLEAYGDENAEYK----ITRNHIKSL-------FVDLVIAGTDTSAQTIEWTMAELIN 333

  Fly   332 QPDIQQRLREEIESVLANVDGGELNYDV-LAQMTYLDQVLSETLRKHPLLPHLI-------RETT 388
            .|:|.:|||||||||:.|.   .|..:. |..:.||..|:.|.||.||  |..:       |...
plant   334 NPNILERLREEIESVVGNT---RLVQETDLPNLPYLQAVVKEGLRLHP--PGAVFLRTFQERCEL 393

  Fly   389 KDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRF-------DPEEVKNRHPMAYLP 446
            |.:.||..       .|.::.|:.|..||:::.:||:|.|.||       ..:|:: ...:.|:|
plant   394 KGFYIPEK-------TLLVVNVYAIMRDPKLWEDPEEFKPERFIASSRSGQEDEIR-EEVLKYMP 450

  Fly   447 FGDGPRNCIG--LRFGKIQAKIGLVS 470
            |..|.|.|.|  |.:..:...||:::
plant   451 FSTGRRGCPGSNLAYVSVGTAIGVMA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 111/467 (24%)
CYP705A32NP_188731.1 p450 16..514 CDD:299894 114/481 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.