DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP72A10

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188082.2 Gene:CYP72A10 / 820692 AraportID:AT3G14640 Length:536 Species:Arabidopsis thaliana


Alignment Length:516 Identity:119/516 - (23%)
Similarity:211/516 - (40%) Gaps:123/516 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SYWKRKGVPHETPLPIVGNMRGIVKKYH---------FRDINQRI----YKKFKGQGPIAGMYMF 75
            ||.:|:|:......|::|:::..|....         ..||..|:    ::..|..|.....::.
plant    59 SYLRRQGLAGTPYTPLIGDLKRNVNMLTEATSKPIKLTEDITPRVLPHPFQMLKTHGRTFFTWLG 123

  Fly    76 FKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDP-LTGHLFA-----LEGEEWRAMRHKLTP 134
            .|.|..|.|.:.||:|..|.:.|         |:... |.|.|.|     .:|::|...|..:.|
plant   124 PKPTITIMDPELIKEVFNKVYDY---------PKAQTFLLGRLIATGIINYDGDKWAKHRRIINP 179

  Fly   135 VFTSGKIKQM--------SKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCA 191
            .|...|||.|        |.|:.:        ..|.|.:.......|::.......|.|||...|
plant   180 AFHIEKIKNMVPAFHQSCSDVVGE--------WSKLVSDKGSSSCEVDVWPWLVSMTGDVISRTA 236

  Fly   192 FGLECNSLQDPSAEFRQKGREIFTRRRH--STLVQSF--IF----------TNARL---ARKLRI 239
            ||          :.::: |:.||..:..  ..::|:|  ::          :|.|:   ||::::
plant   237 FG----------SSYKE-GQRIFELQAELVHLILQAFWKVYIPGYRYLPTKSNRRMKAAAREIQV 290

  Fly   240 KVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDL---------- 294
                         .:|..|:.||:                  .:||.|.....||          
plant   291 -------------ILKGIVNKRLR------------------AREAGKAAPNDDLLGILLESNLG 324

  Fly   295 ---SHGLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELN 356
               .:|::.|.:..:..:|:.||.||:|..:...:..|:...|.|.|.|||::.|..:   .|.:
plant   325 QAKGNGMSTEDVMEECKLFYFAGQETTSVLLVWAMVLLSHHQDWQARAREEVKQVFGD---KEPD 386

  Fly   357 YDVLAQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIY- 420
            .:.|:|:..:..:|.|.||.:|.:.||.|...|:.::  .|:.|..|:...:|:..:..||.:: 
plant   387 TECLSQLKVMTMILYEVLRLYPPVTHLTRAIDKEMKL--GDLTLPAGVHISLPIMLVQRDPMLWG 449

  Fly   421 PEPEKFDPSRF-DPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVS 480
            .:..:|.|.|| |......:..:::.||..|||.|||..|..::||:.:..:|:.|.|.:|
plant   450 TDAAEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQTFTFELS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 115/508 (23%)
CYP72A10NP_188082.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.