DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP72A7

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188079.1 Gene:CYP72A7 / 820689 AraportID:AT3G14610 Length:512 Species:Arabidopsis thaliana


Alignment Length:484 Identity:118/484 - (24%)
Similarity:209/484 - (43%) Gaps:66/484 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KRKGVPHETPLPIVGNM-RGIVKKYHFR--------DINQRI----YKKFKGQGPIAGMYMFFKR 78
            ||:|:......|:||:: |.:......|        ||..|:    .|.....|....:::....
plant    39 KRQGLTGTPYTPLVGDIKRNVDMMMEARSKPINVTDDITPRLLPLALKMLNSHGKTFFIWIGPLP 103

  Fly    79 TALITDLDFIKQVM--IKDFSYFQDRGAFTNPRDDPLTGHLFALEGEEWRAMRHKLTPVFTSGKI 141
            |.:||:.:.||:|.  :.||     ..|.|.|....|.|.|.:.:|::|.:.|..:.|.|...||
plant   104 TIVITNPEQIKEVFNKVNDF-----EKASTFPLIRLLAGGLASYKGDKWASHRRIINPAFHLEKI 163

  Fly   142 KQM--------SKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLECNS 198
            |.|        |:|:........|      ||:.:|   |::.......|.|||...|||   :|
plant   164 KNMIPAFYHCCSEVVCQWEKLFTD------KESPLE---VDVWPWLVNMTADVISHTAFG---SS 216

  Fly   199 LQDPSAEFRQKGR--EIFTRRRHSTLVQSFIFTNARLARKLRIKVLPDDLTQFFMSTVKNTVDYR 261
            .::....|:.:|.  |:..:....:.:....|...:..|  |:|.:..::.......|......|
plant   217 YKEGQRIFQLQGELAELIAQAFKKSYIPGSRFYPTKSNR--RMKAIDREVDVILRGIVSKREKAR 279

  Fly   262 LKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGFETSSSTMSLCL 326
            .......:|.:..::|..:|:.:          .:|:::|.:..:..:|:.||.||:|..:...:
plant   280 EAGEPANDDLLGILLESNSEESQ----------GNGMSVEDVMKECKLFYFAGQETTSVLLVWTM 334

  Fly   327 YELALQPDIQQRLREEIESVLANVDGGELN---YDVLAQMTYLDQVLSETLRKHPLLPHLIRETT 388
            ..|:...|.|.|.|||:..||     ||.|   .:.|..:..:..:.:|.||.:|.:..|.|...
plant   335 VLLSHHQDWQARAREEVMQVL-----GENNKPDMESLNNLKVMTMIFNEVLRLYPPVAQLKRVVN 394

  Fly   389 KDYQIPNSDIVLDKGILALIPVHNIHHDPEIY-PEPEKFDPSRF-DPEEVKNRHPMAYLPFGDGP 451
            |:.::  .::.|..||...:|...:..|.|:: .:...|.|.|| |......::.:::.|||.||
plant   395 KEMKL--GELTLPAGIQIYLPTILVQRDTELWGDDAADFKPERFRDGLSKATKNQVSFFPFGWGP 457

  Fly   452 RNCIGLRFGKIQAKIGLVSLLRRFKFSVS 480
            |.|||..|..::||:.:..:|::|.|.:|
plant   458 RICIGQNFAMLEAKMAMALILQKFSFELS 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 115/479 (24%)
CYP72A7NP_188079.1 p450 21..512 CDD:299894 118/484 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.