DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP705A8

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:520 Identity:119/520 - (22%)
Similarity:223/520 - (42%) Gaps:94/520 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTIALVGVVLGLAYSLHIKIFSYWKRK-----GVPHETP-LPIVGNMRGIVKKYHFRDINQRIYK 61
            |...|:.::|.|   |.|..:|::.:|     .:|...| |||:|::..::..:..|.: |::..
plant     9 FVNCLILILLCL---LSILCYSFFFKKPKDGFNLPPSPPSLPIIGHLHHLLSLFMHRSL-QKLSS 69

  Fly    62 KFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLT-GHLF------- 118
            |:   ||:..:::|.....|::......::       |:.:....:.||.|.. |.||       
plant    70 KY---GPLLYLHVFNVPILLVSSPSIAYEI-------FRAQDVNVSTRDFPTNEGSLFLGSFSFI 124

  Fly   119 -ALEGEEWRAMRHKLTPVFTSGKIKQMSKVI--VDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCA 180
             |..||.|:.|:..:.......:..:.|:.|  .:|.....:.:|||:|:.     :|||.|...
plant   125 TAPYGEYWKFMKKLIVTKLLGPQALERSQRIRANEVERFYSNLLDKAMKKE-----SVEIADEAM 184

  Fly   181 RFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIKVLPDD 245
            :...::|.....|..| |.::..||   :.|.:.|  :...|::.|:.  |.:.||...|:   .
plant   185 KLVNNIICKMIMGRTC-SEENGEAE---RIRGLVT--KSDALLKKFLL--AAILRKPLKKI---G 238

  Fly   246 LTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKG-QGIDL-------------SH 296
            :|.|    .|..:|..||       |.|.:.::..|::|..::. ||.|:             .:
plant   239 ITLF----KKVFMDISLK-------FDEVLEKILVENEERLEENQQGTDIMDKLLEVYGDKTSEY 292

  Fly   297 GLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDV-L 360
            .:|.:.:.:.....|.||.:|::.|:...:.|:.....|.:||||||:||:...   .|..:. |
plant   293 KITRDHIKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGKT---RLIQETDL 354

  Fly   361 AQMTYLDQVLSETLRKHPLLPHLIRE-----TTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIY 420
            ..:.||...:.|.||.||.:|.::|.     |...:.||....::..|       :.|..||:.:
plant   355 PNLLYLQATVKEGLRLHPTIPLVLRTFQDGCTIGGFSIPKKTKLVVNG-------YAIMRDPDNW 412

  Fly   421 PEPEKFDPSRF------DPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSV 479
            .:|.:|.|.||      ..::......:.||.||.|.|.|.|:....:..:..:..:::.|.:.:
plant   413 EDPLEFKPERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYVSVETAIGVMVQCFDWKI 477

  Fly   480  479
            plant   478  477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 111/486 (23%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 105/471 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.