DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and Cyp4d8

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:503 Identity:110/503 - (21%)
Similarity:222/503 - (44%) Gaps:58/503 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFTIALVGVVLGLAYSLHIKIFSYWKRK--GVPHETPLPIVGNMRGIVK--KYHFRDINQRIYK 61
            :||  .||.::.|..:.:|:..... :||  .:|.....|::|.|:.:::  ...|..:.:....
  Fly     2 LLF--LLVVLLFGAGWIIHLGQADR-RRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVL 63

  Fly    62 KFKGQGPIAGMYMFFKRTALITDLDFIKQVM-----IKDFSYFQDRGAFTNPRDDPLTGHLFALE 121
            ||   |.:..:::|.:...:..|.:..:|::     :.....::..|.:       |...|...:
  Fly    64 KF---GHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQW-------LGNGLLLSD 118

  Fly   122 GEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKD----LCARF 182
            |:.|...|..:||.|....::|..:|.        |.......:...::.|....|    :||. 
  Fly   119 GKVWHQRRKIITPTFHFSILEQFVEVF--------DQQSNICVQRLAQKANGNTFDVYRSICAA- 174

  Fly   183 TTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIKVLPDDLT 247
            ..|:|...|.|.:..:..:.|..:.:...|       .|.:.|:.|.:..|..:|...:....|.
  Fly   175 ALDIIAETAMGTKIYAQANESTPYAEAVNE-------CTALLSWRFMSVYLQVELLFTLTHPHLK 232

  Fly   248 QFFMSTVKNTVDYRLKNGIKRNDFIE----QMIELRAEDQEAAKKGQGIDL-------SHGLTLE 301
            ......::...::.:|...||...:|    ::::...||..:.::...:|:       ...||.:
  Fly   233 WRQTQLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTND 297

  Fly   302 QMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYL 366
            ::..:...|...|.:|::|.:|.||:||:..|::|.::.|||..||.......::...|.::.|:
  Fly   298 EIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYM 362

  Fly   367 DQVLSETLRKHPLLPHLIRETTKDYQIPNS---DIVLDKGILALIPVHNIHHDPEIYPEPEKFDP 428
            :.|:.|:||.:|.:|.:.|:...|::..:|   |.|:..|...:|.:..:|..||.:|.|::|.|
  Fly   363 ECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIP 427

  Fly   429 SRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFK 476
            .|.  |......|...:||..|||||||.:|.:::.|:.|..::|.::
  Fly   428 ERH--ENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 102/470 (22%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 95/433 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.