DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and AT3G32047

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001030796.1 Gene:AT3G32047 / 3769237 AraportID:AT3G32047 Length:502 Species:Arabidopsis thaliana


Alignment Length:511 Identity:110/511 - (21%)
Similarity:204/511 - (39%) Gaps:77/511 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTIALVGVVLGLAYSLHIKIFSYWKRK-----GVPHETP-LPIVGNMRGIVKKYHFRDINQRIYK 61
            |...|:.:::.|...|.:.:|.:.|.|     .:|...| |||:|::..|:.....:.. |.|..
plant     9 FQNCLIFILISLFSLLCLFVFVFKKPKDSRGCDLPPSPPSLPIIGHLHLILSTLPHKSF-QNISS 72

  Fly    62 KFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPL----TGHLFALEG 122
            |:   ||:..:..|.....|.:..:...::...........|  ..|.|:.|    :..:.|..|
plant    73 KY---GPLLLLRFFNVPVVLKSSANVAYEIFKTHDVNISSHG--HPPIDECLFFGSSSFVVAPYG 132

  Fly   123 EEWRAMRH-KLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDV 186
            ..||.|:. .:|.:|....::::..|..|...|....:  ..||.|.|  .|:|.....:.|.:.
plant   133 YYWRLMKKLMVTKLFGPQALERLRHVREDELERFHTNL--LSKEMKGE--TVQIAKEAIKLTNNS 193

  Fly   187 IGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNA--RLARKLRIKVLPDDLTQF 249
            :.....|..|......:|..|....|.|      .||:....|..  ||...|.|.:...::.  
plant   194 VCKMIMGRSCLEENGDAARVRGLVTETF------ALVKKIFLTQVLRRLFEILGISLFKKEIL-- 250

  Fly   250 FMSTVKNTVDYRLKNGIKR--NDFIEQMIELRAEDQEAAKKGQGIDL----------SHGLTLEQ 302
                           |:.|  ::|:|::: :..:::...:.|..:|:          .:.:|...
plant   251 ---------------GVSRKFDEFLEKIL-VEHDEKPDFQGGDMMDVLLAAYRDENAEYKITRNH 299

  Fly   303 MAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLD 367
            :.:......:.|.:||:.|:...:.|:..:|:|.::||:|::||:...  ..:....|..:.||.
plant   300 IKSLFAELILGGTDTSAQTIEWTMAEIINKPNILEKLRKELDSVVGKT--RLIEEKDLPNLPYLQ 362

  Fly   368 QVLSETLRKHPLLPHLIRE-----TTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFD 427
            .|:.|.||.||..|...|:     |.|.|.:|       |....::..:.:..||..:.:|::|.
plant   363 SVVKEGLRLHPPAPVFGRKVLEGCTIKGYYVP-------KNTALVVNAYAVMRDPHYWEDPDEFK 420

  Fly   428 PSRF----DPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSV 479
            |.||    ..:|.:....:.|:|||.|.|.|.|:..|.|.....:..::..|.:.|
plant   421 PERFLTTSSKKEEEREQELKYIPFGSGRRGCPGVNLGYIFVGTAIGMMVHCFDWRV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 103/477 (22%)
AT3G32047NP_001030796.1 p450 59..496 CDD:299894 96/461 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.