DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and Cyp310a1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster


Alignment Length:523 Identity:128/523 - (24%)
Similarity:253/523 - (48%) Gaps:64/523 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVGVVLGLAYSLHIK-IFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDIN--QRIYKKFK-GQG 67
            |:.::|..|..|.:: |:|:|:|:|.|.|.    .|.....::|.:.|:..  :.|.:.:: |:.
  Fly     4 LLPILLYSAVFLSVRHIYSHWRRRGFPSEK----AGITWSFLQKAYRREFRHVEAICEAYQSGKD 64

  Fly    68 PIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGH-LFALEGEEWRAMRHK 131
            .:.|:|.||:...|:.:::..:.::      .|..|.|:..:.|.::|: .|.|        ..|
  Fly    65 RLLGIYCFFRPVLLVRNVELAQTIL------QQSNGHFSELKWDYISGYRRFNL--------LEK 115

  Fly   132 LTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEG-----NVEIKDLCARFTTDVIGSCA 191
            |.|:|.:.::.:|...:..||       |..:......:|     .|:|:.....::.::|.:..
  Fly   116 LAPMFGTKRLSEMFGQVQKVG-------DHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLI 173

  Fly   192 FGLECNSLQDPSAEFRQKGREIFTRRRHS-TLVQSFIFTNARLARKLRIKVLPDDLTQFFMSTVK 255
            :||:.|:       |..:...:.:...|| ..:||  ||..||.:|       ...|......:|
  Fly   174 YGLDINN-------FEHEDHILTSYLSHSQASIQS--FTLGRLPQK-------SSYTYRLRDLIK 222

  Fly   256 NTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHG---LTLEQMAAQAFVFFVAGFET 317
            .:|:.|..:|:.|.|.::.::..|..::.:..|.|...::..   |:::::|..|........:.
  Fly   223 QSVELREDHGLIRKDILQLLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAKVAEDLLKVSLDA 287

  Fly   318 SSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPH 382
            .:||::..|.|:..:|.|.::||.||:. |:| :.|:|.::.|..:.|:|..|.|||||:|.||.
  Fly   288 VASTVTFTLLEILQEPLIVEKLRAEIKE-LSN-ENGQLKFEELNGLRYMDMCLKETLRKYPPLPI 350

  Fly   383 LIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRF-----DPEEVKNR-HP 441
            :.|...|.|.:|||...:|:|...::|:..:|.|.:.:.||.|:.|.||     |..:.::: ..
  Fly   351 IERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTANDVGQCEDKTKS 415

  Fly   442 MAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSV-SNRTDVPLIFSKKSFLLTTNDGIYLK 505
            ..::.||.|...|:|..|.|:..|:.|:.||:.|...: :|:.....:..:.:..:.|.||:.:|
  Fly   416 NVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPFIHTKDGLKVK 480

  Fly   506 VER 508
            ::|
  Fly   481 LKR 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 117/493 (24%)
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 105/423 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
55.020

Return to query results.
Submit another query.