DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and Cyp6t1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster


Alignment Length:518 Identity:171/518 - (33%)
Similarity:273/518 - (52%) Gaps:25/518 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFTIALVG---VVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVK-KYHFRDINQRIYK 61
            :|..:.|.|   :|:.:.:...|..|.:|:|.|||.....|.|||:..::: ...|.|..:.:|:
  Fly    18 VLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFVGNVWNLLRGACCFGDQFRELYE 82

  Fly    62 KFKGQG-PIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPL-TGHLFALEGEE 124
            ..:..| ...|:.:......|:.|...||::|::||:.|..|...|:|..|.: :.:||..:.|.
  Fly    83 SKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYET 147

  Fly   125 WRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGS 189
            ||.......|.|.:||::.|..::.::|.:|.:.|::  |.:..:...:|:|.|||.||||:|.|
  Fly   148 WRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQ--KLSGRDSMELEVKQLCALFTTDIIAS 210

  Fly   190 CAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIKVLPDDLTQFFMSTV 254
            .|||:|.:|||:|.||||:...|:...|....|....:|...||:.::...:..::..:|...::
  Fly   211 LAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSM 275

  Fly   255 KNTVDYRLKNGIKRNDFIEQMIEL-RAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGFETS 318
            ...:..|.::|..|:|.|:..::| |.|..|:        :.|  ..:..||||....:|||:||
  Fly   276 DYVLSQRAESGENRHDLIDIFLQLKRTEPAES--------IIH--RPDFFAAQAAFLLLAGFDTS 330

  Fly   319 SSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPHL 383
            |||::..|||||....||.|||.|:.:.|.:....:|:.|.:..:.||.||:.|.||.:|....|
  Fly   331 SSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFL 395

  Fly   384 IR--ETTKDYQIP----NSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPM 442
            .|  .:...|.:.    .|...|..|....|.|..||.|.:.:|.||.|||.||..|:.:..|||
  Fly   396 DRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPM 460

  Fly   443 AYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSFLLTTNDGIYLK 505
            .|||||.|||.|||...|:::.|:||:.:|..|:..|..||...:.|..|:|:||.::|.||:
  Fly   461 TYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 161/484 (33%)
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 147/435 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.