DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:233 Identity:65/233 - (27%)
Similarity:107/233 - (45%) Gaps:34/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLP--IVGNMRGIVKK---------YHFRD 54
            ::.|..||.:|..:.|.:..:...:..|..:....|.|  ::||::.|:::         |   |
 Worm     4 LILTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSY---D 65

  Fly    55 INQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNP---RDDPLTGH 116
            ...:::|:|   |...|:|...:....||:.:.||:|.||:||.|.||   |.|   .|:.|...
 Worm    66 WYNKLHKQF---GETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDR---TPPPIIEDNKLKES 124

  Fly   117 LFALEGEE-WRAMRHKLTPVFTSGKIKQMSKVI---VDVGLRLGDAMDKAVKEAKVEEGNVEIKD 177
            |.....|. |:..|..:.|:|::||:|.|.:.|   ||:.|.:       :||........:|.|
 Worm   125 LLQNTYESGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEI-------LKEKASSGQKWDIYD 182

  Fly   178 LCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFT 215
            .....|.||||.|||.::.|..:|.:..|....|:..|
 Worm   183 DFQGLTLDVIGKCAFAIDSNCQRDRNDIFYVNARKFIT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 59/202 (29%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 57/193 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.