DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and cest-32

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:228 Identity:43/228 - (18%)
Similarity:76/228 - (33%) Gaps:81/228 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 FFVAGFETSSSTMSLCLYELALQPDIQQRLREEIES--------VLANVDGGELNYDVLAQMTYL 366
            |...|.|.|.....|....|||     :.::|.|:|        .:.....|.::..:||...:.
 Worm   165 FMTTGDEVSRGNYGLWDQTLAL-----KWVQEHIKSFGGNPNIVTVCGTSAGGVSAGLLALSPHS 224

  Fly   367 DQVLSE------------TLRKHPLLPHLIRETTK--DYQIPNSDIVLD---------------- 401
            :::...            ::|.......:.|...|  .|:..:|:.:|:                
 Worm   225 NKLFHRFMAMSGSAFCEFSIRTKEQEAEIFRNFAKHHGYEGEDSESLLEWYKSQPLSKFQETATF 289

  Fly   402 ----KGILALIPVHNIHHDPEIYPEPEKFDP-SRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGK 461
                .|.|..||    :.|.:.:|:|  ||. ||    |......||.:...:|           
 Worm   290 EKKASGFLTFIP----NFDGDFFPKP--FDELSR----EAPKLDAMATVDEYEG----------- 333

  Fly   462 IQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSF 494
                :|.:::.:      |.|.|:.:|  |.||
 Worm   334 ----LGFLTMFQ------SRRNDMDII--KSSF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 43/228 (19%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 43/228 (19%)
Aes <104..>227 CDD:223730 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.