Sequence 1: | NP_001286199.1 | Gene: | Cyp6a14 / 35835 | FlyBaseID: | FBgn0033302 | Length: | 509 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504397.1 | Gene: | cest-32 / 178909 | WormBaseID: | WBGene00016862 | Length: | 545 | Species: | Caenorhabditis elegans |
Alignment Length: | 228 | Identity: | 43/228 - (18%) |
---|---|---|---|
Similarity: | 76/228 - (33%) | Gaps: | 81/228 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 FFVAGFETSSSTMSLCLYELALQPDIQQRLREEIES--------VLANVDGGELNYDVLAQMTYL 366
Fly 367 DQVLSE------------TLRKHPLLPHLIRETTK--DYQIPNSDIVLD---------------- 401
Fly 402 ----KGILALIPVHNIHHDPEIYPEPEKFDP-SRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGK 461
Fly 462 IQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSF 494 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cyp6a14 | NP_001286199.1 | p450 | 32..506 | CDD:306555 | 43/228 (19%) |
cest-32 | NP_504397.1 | COesterase | 15..516 | CDD:278561 | 43/228 (19%) |
Aes | <104..>227 | CDD:223730 | 14/66 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D264519at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |