DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and CYP26A1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_000774.2 Gene:CYP26A1 / 1592 HGNCID:2603 Length:497 Species:Homo sapiens


Alignment Length:545 Identity:124/545 - (22%)
Similarity:207/545 - (37%) Gaps:146/545 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LFTIALVGVVLGLAYSL-HIKIFSYWKRKGVPHETPLPIVGNMRG----------IVKKYHFRDI 55
            |...||...||.|...| .||::..:...|......||:.....|          ::::..|..:
Human     6 LLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM 70

  Fly    56 NQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFAL 120
            .:|.|      |.|...::|.:.|..:...|.::::::.:                      ..|
Human    71 KRRKY------GFIYKTHLFGRPTVRVMGADNVRRILLGE----------------------HRL 107

  Fly   121 EGEEWRAMRHKLTPVFTSGKI--------KQMSKVIVDVGLRLGDAMDKAVKEAKVEEGN----- 172
            ....|.|   .:..:..||.:        ||..|||:....|  :|::..|.....|.|:     
Human   108 VSVHWPA---SVRTILGSGCLSNLHDSSHKQRKKVIMRAFSR--EALECYVPVITEEVGSSLEQW 167

  Fly   173 -----------VEIKDLCARFTTDVIGSCAFGL--ECNSLQDPSAEFRQKGREIFTRRRHSTLVQ 224
                       .|:|.|..|....::..|...|  :.:|.|.....|.:..|.:|:         
Human   168 LSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFS--------- 223

  Fly   225 SFIFTNARLARKLRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIE--LRAE--DQEA 285
                             ||.|:.  |..         |..|:|..:.|...||  :||:  ...|
Human   224 -----------------LPIDVP--FSG---------LYRGMKARNLIHARIEQNIRAKICGLRA 260

  Fly   286 AKKGQG------IDLSHG------LTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQR 338
            ::.|||      :.:.|.      |.::.:...:......|.||::|..:..:..|.|.|.:.|:
Human   261 SEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQK 325

  Fly   339 LREEIES----VLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPHLIRETTK-----DYQIP 394
            :|||::|    ..:|.| .:|:.::|.|:.|:..|:.||||.:|.:|...|...|     .||||
Human   326 VREELKSKGLLCKSNQD-NKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIP 389

  Fly   395 NSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRF---DPEEVKNRHPMAYLPFGDGPRNCIG 456
                   ||...:..:.:.|...||:...|:|:|.||   .||:...   .:::|||.|.|:|:|
Human   390 -------KGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASR---FSFIPFGGGLRSCVG 444

  Fly   457 LRFGKIQAKIGLVSLLRRFKFSVSN 481
            ..|.||..||..|.|.|...:.:.|
Human   445 KEFAKILLKIFTVELARHCDWQLLN 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 114/514 (22%)
CYP26A1NP_000774.2 p450 14..492 CDD:299894 121/537 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.