DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and Cyp26a1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_031837.2 Gene:Cyp26a1 / 13082 MGIID:1096359 Length:497 Species:Mus musculus


Alignment Length:507 Identity:109/507 - (21%)
Similarity:195/507 - (38%) Gaps:140/507 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHETPLPIVG-NMRGIVKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKD 95
            |.....|..| .::.::::..|..:.:|.|      |.|...::|.:.|..:...|.::::::  
Mouse    46 PGTMGFPFFGETLQMVLQRRKFLQMKRRKY------GFIYKTHLFGRPTVRVMGADNVRRILL-- 102

  Fly    96 FSYFQDRGAFTNPRDDPLTGHLFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGL--RLGDA 158
                                      ||      |:|..|.....:    :.|:..|.  .|.|:
Mouse   103 --------------------------GE------HRLVSVHWPASV----RTILGAGCLSNLHDS 131

  Fly   159 MDKAVKEAKVEEGNVEIKDLCARFTTDVIGSC-AFGLECNSLQDPSAEFRQKGREIFTRRRHSTL 222
            ..|..|:..::..:.|..........:.:.|| ...|.|.          ::|..::..      
Mouse   132 SHKQRKKVIMQAFSREALQCYVPVIAEEVSSCLEQWLSCG----------ERGLLVYPE------ 180

  Fly   223 VQSFIFTNARLARKLRIKVLP---------DDLTQFFMSTVKN----TVD------YRLKNGIKR 268
            |:..:|   |:|.::.:...|         ..|.:.|....:|    .:|      ||   |:|.
Mouse   181 VKRLMF---RIAMRILLGCEPGPAGGGEDEQQLVEAFEEMTRNLFSLPIDVPFSGLYR---GVKA 239

  Fly   269 NDFIEQMIE---------LRAEDQEAA-------------KKGQGIDLSHGLTLEQMAAQAFVFF 311
            .:.|...||         |:|.:.:..             ::|:.:|:.   .|:|.:.:   ..
Mouse   240 RNLIHARIEENIRAKIRRLQATEPDGGCKDALQLLIEHSWERGERLDMQ---ALKQSSTE---LL 298

  Fly   312 VAGFETSSSTMSLCLYELALQPDIQQRLREEIES----VLANVDGGELNYDVLAQMTYLDQVLSE 372
            ..|.||::|..:..:..|.|.|.:.|::||||:|    ..:|.| .:|:.:.|.|:.|...|:.|
Mouse   299 FGGHETTASAATSLITYLGLYPHVLQKVREEIKSKGLLCKSNQD-NKLDMETLEQLKYTGCVIKE 362

  Fly   373 TLRKHPLLPHLIRETTK-----DYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRF- 431
            |||.:|.:|...|...|     .||||       ||...:..:.:.|...:|:...|:|:|.|| 
Mouse   363 TLRLNPPVPGGFRVALKTFELNGYQIP-------KGWNVIYSICDTHDVADIFTNKEEFNPDRFI 420

  Fly   432 --DPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSN 481
              .||:...   .:::|||.|.|:|:|..|.||..||..|.|.|...:.:.|
Mouse   421 VPHPEDASR---FSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLN 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 109/507 (21%)
Cyp26a1NP_031837.2 p450 43..491 CDD:299894 109/507 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.