DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a14 and tbxas1

DIOPT Version :9

Sequence 1:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_031753608.1 Gene:tbxas1 / 100327243 XenbaseID:XB-GENE-994325 Length:532 Species:Xenopus tropicalis


Alignment Length:533 Identity:163/533 - (30%)
Similarity:277/533 - (51%) Gaps:48/533 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQGP 68
            |:.||...|||.|...:..|...::.|:.|..|||.:||:  ::.:..|.:.::.:.|.:   ||
 Frog    15 TLTLVAGFLGLLYWYSVSAFWQLEKAGIKHPKPLPFIGNI--MLFQKGFWEGDRHLLKTY---GP 74

  Fly    69 IAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFALEGEEWRAMRHKLT 133
            |.|.||..:...:|.:.|.||||:.|||..|.:|....|....|::..|..|..::|:.:|..||
 Frog    75 ICGYYMGRRPMIVIAEPDAIKQVLQKDFVNFTNRMQRLNLVTKPMSDSLLCLRDDKWKRVRSVLT 139

  Fly   134 PVFTSGKIKQMSKVI---VDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLE 195
            |.|::.::|:|..:|   .||  .:.:.|:.|   :..|..||:....|  ||.||:.|.|||.:
 Frog   140 PSFSAARMKEMCPLINQCCDV--LVENLMEYA---SSGEACNVQRCYAC--FTMDVVASVAFGTQ 197

  Fly   196 CNSLQD---PSAEFRQKGREIFTRRRHSTLV-QSFIFTNARLARKLRIKVLPDDLTQFFMSTVKN 256
            .:|.:|   |..:..::..|:||..:...|: .:|......:||:|..| ..|.:..||:..:::
 Frog   198 VDSQRDSDHPLVQNCKRFLELFTPFKPVVLLCLAFPSIMIPIARRLPNK-HRDRINSFFLKVIRD 261

  Fly   257 TVDYRLKN--GIKRNDFIEQMIELR---------------------AEDQEAAKKGQGIDLSHGL 298
            .:.:|...  ..:|.||::.|::.|                     .::|:..:..........|
 Frog   262 IIAFRENQPPNERRRDFLQLMLDARDSAGHVSVDHFDIVNQADLSVPQNQDRGQDPPRKSTQKTL 326

  Fly   299 TLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQM 363
            ..|::..|||:|.:||:||:.|.:|...|.||..||.|::|.:|::..  :.:..|.:|:.:..:
 Frog   327 NEEEILGQAFIFLIAGYETTCSLLSFASYLLATHPDCQEKLLKEVDEF--SQEHEEADYNTVHDL 389

  Fly   364 TYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDP 428
            .|::.|::||||.:|......||..:|..:  ..:.:..|.:..||:..:.:||..:.|||||:|
 Frog   390 PYMEMVINETLRMYPPAYRFAREAARDCTV--MGLGIPAGAVVEIPIGCLQNDPRFWHEPEKFNP 452

  Fly   429 SRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKS 493
            .||..||.:.|||..:||||.|||:|||:|...::|||.|..:||:|:|...:.|.:||..|..:
 Frog   453 ERFTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITLYRVLRKFRFQTCDLTQIPLQLSAMT 517

  Fly   494 FLLTTNDGIYLKV 506
             .|...||:|::|
 Frog   518 -TLRPKDGVYVRV 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 153/503 (30%)
tbxas1XP_031753608.1 cytochrome_P450 71..526 CDD:425388 144/470 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm9369
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.