DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and CRH1

DIOPT Version :9

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_011705.1 Gene:CRH1 / 853102 SGDID:S000003421 Length:507 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:10/38 - (26%)
Similarity:19/38 - (50%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGN 47
            :.|..::.|...||:.:.| |::|.:.:..|....|.|
Yeast   262 KYTYGDQSGSWESIEADGG-SIYGRYDQAQEDFAVLAN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 10/38 (26%)
CRH1NP_011705.1 GH16_fungal_CRH1_transglycosylase 74..258 CDD:185692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.