powered by:
Protein Alignment CG12780 and CRR1
DIOPT Version :9
Sequence 1: | NP_610388.1 |
Gene: | CG12780 / 35834 |
FlyBaseID: | FBgn0033301 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013314.1 |
Gene: | CRR1 / 850910 |
SGDID: | S000004203 |
Length: | 422 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 36 |
Identity: | 7/36 - (19%) |
Similarity: | 14/36 - (38%) |
Gaps: | 12/36 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80
:|..||| ||...:::.....:::|
Yeast 250 VGADTWA------------TYHTYEIDWDPDRIIWY 273
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345591 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.