DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and CRR1

DIOPT Version :9

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_013314.1 Gene:CRR1 / 850910 SGDID:S000004203 Length:422 Species:Saccharomyces cerevisiae


Alignment Length:36 Identity:7/36 - (19%)
Similarity:14/36 - (38%) Gaps:12/36 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80
            :|..|||            ||...:::.....:::|
Yeast   250 VGADTWA------------TYHTYEIDWDPDRIIWY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 7/36 (19%)
CRR1NP_013314.1 ChtBD1_GH16 29..75 CDD:211314
GH16_fungal_CRH1_transglycosylase 143..354 CDD:185692 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345591
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.